Home
SUBMIT
Overload
Example of output
SOAP tutorial
Contact us
menu

Meta-Prediction of job: 775191

THE FINAL CONSENSUS PREDICTON:
Your protein is predicted to be extracellular with probability 52.46%.

extracellular52.46 %
outer membrane0.0 %
periplasmic0.0 %
plasma membrane0.0 %
cytoplasmic47.54 %
To see detailed results click here -->  

THE SUMMARY OF PRIMARY PREDICTIONS


presence or absence of signal/tm/beta-barrel in the sequence
SIGNAL PREDICTION SignalP
SPOCTOPUS
Phobius
[Tat] PRED-Tat
[Lipo] LipoP no signal
[Lipo] Dolop
TRANSMEMBRANE ALPHA-HELIX PREDICTION PHOBIUS
SPOCTOPUS
TMHMM
BETA-BARREL OMP PREDICTION BOMP
tmbHunt
SUBCELLULAR LOCALIZATION PREDICTIORS PSROTb3 unknown
PSLpredcytoplasmic
Sosui-GramNcytoplasmic
CELLOcytoplasmic

BlastP
No ID Localization Gene Ontology (GO) Score (bits) E-value
1 Q9ZLX4 Cytoplasm (By similarity). GO:0005737; C:cytoplasm; IEA:UniProtKB-SubCell. 84 2e-16
2 O25242 Cytoplasm (By similarity). GO:0005737; C:cytoplasm; IEA:UniProtKB-SubCell. 82 4e-16


THE OUTPUTS OF PRIMARY PREDICTIONS



SIGNAL PREDICTION

Lipoprotein predictors

Dolop
prediction: it is not a lipoprotein

How to read result! http://www.mrc-lmb.cam.ac.uk/genomes/dolop/analysis.shtml

LipopP
CYT score=-0.200913
Cut-off=-3
Best	CYT	1	1	-0.200913
NO PLOT made - less than 4 putative cleavage sites predicted
NO PLOT made - less than 4 putative cleavage sites predicted

How to read result!

Tat predictors

SignalP
prediction: Non-secretory protein
Signal peptide probability: 0.003
Max cleavage site probability: 0.002 between pos. 23 and 24

MKLSINKNTLESAVILCNAYVEKK-DSSTITSHLFFHADEDKLLIKASDYEIGINYKIKKIRVESSGFATA [0.002]
  • Signal peptide
  • Max cleavage site probability
  • Aged protein

/MetaLocGramN/resultfiles/775191/775191.signalP.nn.png
/MetaLocGramN/resultfiles/775191/775191.signalP.hmm.png

How to read result!

TRANSMEMBRANE ALPHA-HELIX PREDICTIONS

TMHMM
inside	     1   106

Detailed information:
Exp number of AAs in TMHs: 0.00036
Exp number, first 60 AAs:  0.00018
Total prob of N-in:        0.57981

/MetaLocGramN/resultfiles/775191/775191.TMHMM.small.png

How to read result!

SPOCTOPUS PHOBIUS
prediction: 0 helices found

Topo_Dom      1    106       Non Cytoplasmic.

/MetaLocGramN/resultfiles/775191/775191.phobius.small.png

How to read result!: http://phobius.sbc.su.se/instructions.html

BETA-BARREL OMP PREDICTION

tmbHunt
prediction: no beta-barrel found

Score: -0.007730 from 6BBTMprotein to -6BBTMprotein
-----------------------

Probability based scoring:

-----------------------

Empirical scores:-

 Empirical Probability of a NON-BETA BARREL protein with this BBTM score: 0.178780
 Empirical data - BBTM_score (1=bbtm -1=non bbtm): -0.007730
 Empirical data - log P BBTM/NTM protein ratio: -0.044200
 (Given no. sequences queried) Empirical data E-value: 0.000000

Observed scores:-

 Probability of a NON-BETA BARREL protein with this score: 0.358859
Log P BBTM/Non BBTM protein ratio: -1.065915

Conclusion: Non BBMP

------------------------

How to read result! http://bmbpcu36.leeds.ac.uk/~andy/betaBarrel/AACompPred/help.html

bomp

prediction: no beta-barrel found

How to read result! http://services.cbu.uib.no/tools/bomp/Information/outputinfo

SUBCELLULAR LOCALIZATION PREDICTIORS

Cello
prediction:cytoplasmic
  
Analysis Report:
            SVMLOCALIZATIONRELIABILITY
    Amino Acid Comp.    Cytoplasmic    0.435
    N-peptide Comp.    Cytoplasmic    0.866
    Partitioned seq. Comp.    Cytoplasmic    0.400
    Physico-chemical Comp.    Cytoplasmic    0.599
    Neighboring seq. Comp.    Cytoplasmic    0.769

CELLO Prediction:
     Cytoplasmic    3.069  *
     Extracellular    0.773
     Periplasmic    0.673
     OuterMembrane    0.306
     InnerMembrane    0.180

How to read result! http://cello.life.nctu.edu.tw/cello.html

sosuiGramN
prediction: cytoplasmic

How to read result! http://bp.nuap.nagoya-u.ac.jp/sosui/sosuigramn/sosuigramn_submit.html

PSORTb3
prediction: unknown
Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Unknown                       [No matches against database]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    2.00
    Cytoplasmic            2.00
    OuterMembrane          2.00
    Periplasmic            2.00
    Extracellular          2.00
  Final Prediction:
    Unknown

How to read result! http://cello.life.nctu.edu.tw/cello.html

PSLpred
prediction:cytoplasmic

Predicted Subcellular Localization:  cytoplasmic
Reliability Index=0.2
Expected Accuracy=~0.531

How to read result! http://www.imtech.res.in/raghava/pslpred/help.html