QA-RecombineIt results for job id CASP_T0523_140916UgX7oc

QA: quality assessment mode.

Summary

Here are the results of the QA mode, in which our server calculated quality assessment of the submitted models.

The models presented here are ordered according to the MQAPcomb global score. Rank models by: MQAPmulti MQAPsingle MetaMQAP ProQ2 GOAP DFIRE .
The number of the best models presented here is 10. Display different number of models: 5 20 50 .
The local model quality along the sequence is based on the MetaMQAP local score. Choose another score of local model quality: MQAPcomb MQAPmulti ProQ2 MQAPsingle

Please note that this website has been tested and optimized for Mozilla, Firefox, Opera, and Chrome.

Tools

RecombineIt submission, basic mode

In this basic mode, RecombineIt will create models similar to at least one of the 5 initial models ranked the best by MQAPcomb.

Fragments for merging will be selected according to the local quality predicted by MetaMQAP.

Sequence 1D information

Here, you can find PREDICTED secondary structure, solvent accessibility and protein order. The predictions were performed for the submitted target sequence.

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structue
Solvent Accessibility
Protein Order

Model quality assessment

This section presents the Quality Assessment of the models submitted by you.
These models are ordered according to the MQAPcomb global score. The top model is the one with the highest predicted global accuracy.
Also the local model accuracy, as the MetaMQAP score, is presented as a heat map. The colors correspond to the local error expressed in Angstrom.
Colors are in the range from BLUE: 0 Angstroms to RED: 8 Angstroms and more.

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
 
MODEL NAME
glob: MQAPcomb
 loc: MetaMQAP: 0Å 
 
 8Å
 
0.780    0.800
0.764    0.774
0.756    0.790
0.740    0.774
0.739    0.800
0.733    0.800
0.731    0.800
0.728    0.800
0.727    0.800
0.725    0.755

Detailed information

BEST MODEL 1
(QUARK_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7803    MQAPmulti: 0.7999    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6095    MetaMQAP: 0.5315    ProQ2: 0.4421       
Pseudo-energy (x10^4 J): GOAP: -1.3135    DFIRE: -0.9186
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 2
(RaptorX-Boost_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7641    MQAPmulti: 0.7739    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6207    MetaMQAP: 0.6513    ProQ2: 0.4409       
Pseudo-energy (x10^4 J): GOAP: -1.2206    DFIRE: -0.8668
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 3
(Jiang_Assembly_TS4)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7564    MQAPmulti: 0.7896    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5920    MetaMQAP: 0.5420    ProQ2: 0.4681       
Pseudo-energy (x10^4 J): GOAP: -1.2664    DFIRE: -0.8724
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 4
(RaptorX_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7399    MQAPmulti: 0.7739    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6229    MetaMQAP: 0.6954    ProQ2: 0.4409       
Pseudo-energy (x10^4 J): GOAP: -1.2206    DFIRE: -0.8668
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 5
(Zhang-Server_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7390    MQAPmulti: 0.7998    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5484    MetaMQAP: 0.5945    ProQ2: 0.0045       
Pseudo-energy (x10^4 J): GOAP: -1.2648    DFIRE: -0.8992
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 6
(Zhang-Server_TS3)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7327    MQAPmulti: 0.7998    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5867    MetaMQAP: 0.5294    ProQ2: 0.3973       
Pseudo-energy (x10^4 J): GOAP: -1.1991    DFIRE: -0.8974
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 7
(BAKER-ROSETTASERVER_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7309    MQAPmulti: 0.7996    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5827    MetaMQAP: 0.5924    ProQ2: 0.4423       
Pseudo-energy (x10^4 J): GOAP: -1.4636    DFIRE: -0.8990
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 8
(Jiang_Assembly_TS3)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7276    MQAPmulti: 0.7998    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5867    MetaMQAP: 0.5525    ProQ2: 0.4190       
Pseudo-energy (x10^4 J): GOAP: -1.2307    DFIRE: -0.8602
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 9
(Jiang_THREADER_TS5)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7270    MQAPmulti: 0.7998    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5860    MetaMQAP: 0.5378    ProQ2: 0.4190       
Pseudo-energy (x10^4 J): GOAP: -1.2307    DFIRE: -0.8602
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 10
(chunk-TASSER_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7248    MQAPmulti: 0.7552    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5987    MetaMQAP: 0.4790    ProQ2: 0.3627       
Pseudo-energy (x10^4 J): GOAP: -0.9892    DFIRE: -0.8459
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


Valid HTML 4.01!