QA-RecombineIt results for job id CASP_T0523_140916UgX7oc

QA: quality assessment mode.

Summary

Here are the results of the QA mode, in which our server calculated quality assessment of the submitted models.

The models presented here are ordered according to the MetaMQAP global score. Rank models by: MQAPcomb MQAPmulti MQAPsingle ProQ2 GOAP DFIRE .
The number of the best models presented here is 20. Display different number of models: 5 10 50 .
The local model quality along the sequence is based on the MetaMQAP local score. Choose another score of local model quality: MQAPcomb MQAPmulti ProQ2 MQAPsingle

Please note that this website has been tested and optimized for Mozilla, Firefox, Opera, and Chrome.

Tools

RecombineIt submission, basic mode

In this basic mode, RecombineIt will create models similar to at least one of the 5 initial models ranked the best by MetaMQAP.

Fragments for merging will be selected according to the local quality predicted by MetaMQAP.

Sequence 1D information

Here, you can find PREDICTED secondary structure, solvent accessibility and protein order. The predictions were performed for the submitted target sequence.

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structue
Solvent Accessibility
Protein Order

Model quality assessment

This section presents the Quality Assessment of the models submitted by you.
These models are ordered according to the MetaMQAP global score. The top model is the one with the highest predicted global accuracy.
Also the local model accuracy, as the MetaMQAP score, is presented as a heat map. The colors correspond to the local error expressed in Angstrom.
Colors are in the range from BLUE: 0 Angstroms to RED: 8 Angstroms and more.

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
 
MODEL NAME
glob: MetaMQAP
 loc: MetaMQAP: 0Å 
 
 8Å
 
0.700    0.662
0.695    0.740
0.670    n/a
0.662    0.661
0.655    0.698
0.651    0.764
0.643    0.645
0.599    0.630
0.595    0.739
0.592    0.731
0.592    0.691
0.588    0.637
0.580    n/a
0.576    0.656
0.576    0.713
0.576    0.656
0.571    0.660
0.569    0.700
0.569    0.709
0.565    0.627

Detailed information

BEST MODEL 1
(IntFOLD-TS_TS3)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6624    MQAPmulti: 0.7347    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5907    MetaMQAP: 0.6996    ProQ2: 0.4149       
Pseudo-energy (x10^4 J): GOAP: -1.3647    DFIRE: -0.9205
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 2
(RaptorX_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7399    MQAPmulti: 0.7739    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6229    MetaMQAP: 0.6954    ProQ2: 0.4409       
Pseudo-energy (x10^4 J): GOAP: -1.2206    DFIRE: -0.8668
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 3
(BAKER-ROSETTASERVER_TS4)
Clustering MQAPs (GDT_TS) :  MQAPcomb: n/a    MQAPmulti: 0.7552    
Single model MQAPs (GDT_TS):  MQAPsingle: n/a    MetaMQAP: 0.6702    ProQ2: n/a       
Pseudo-energy (x10^4 J): GOAP: -1.4674    DFIRE: -0.9566
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 4
(IntFOLD-TS_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6609    MQAPmulti: 0.7347    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5888    MetaMQAP: 0.6618    ProQ2: 0.4149       
Pseudo-energy (x10^4 J): GOAP: -1.3647    DFIRE: -0.9205
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 5
(ZHOU-SPARKS-X_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6979    MQAPmulti: 0.7756    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5880    MetaMQAP: 0.6555    ProQ2: 0.4647       
Pseudo-energy (x10^4 J): GOAP: -1.2618    DFIRE: -0.8814
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 6
(RaptorX-Boost_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7641    MQAPmulti: 0.7739    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6207    MetaMQAP: 0.6513    ProQ2: 0.4409       
Pseudo-energy (x10^4 J): GOAP: -1.2206    DFIRE: -0.8668
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 7
(RaptorX-MSA_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6455    MQAPmulti: 0.7468    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5977    MetaMQAP: 0.6429    ProQ2: 0.4150       
Pseudo-energy (x10^4 J): GOAP: -1.2632    DFIRE: -0.8817
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 8
(BAKER-ROSETTASERVER_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6302    MQAPmulti: 0.7233    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5851    MetaMQAP: 0.5987    ProQ2: 0.4362       
Pseudo-energy (x10^4 J): GOAP: -1.2597    DFIRE: -0.8931
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 9
(Zhang-Server_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7390    MQAPmulti: 0.7998    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5484    MetaMQAP: 0.5945    ProQ2: 0.0045       
Pseudo-energy (x10^4 J): GOAP: -1.2648    DFIRE: -0.8992
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 10
(BAKER-ROSETTASERVER_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7309    MQAPmulti: 0.7996    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5827    MetaMQAP: 0.5924    ProQ2: 0.4423       
Pseudo-energy (x10^4 J): GOAP: -1.4636    DFIRE: -0.8990
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 11
(QUARK_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6910    MQAPmulti: 0.7998    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5877    MetaMQAP: 0.5924    ProQ2: 0.4261       
Pseudo-energy (x10^4 J): GOAP: -1.2394    DFIRE: -0.9088
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 12
(Jiang_Assembly_TS5)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6365    MQAPmulti: 0.6919    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5055    MetaMQAP: 0.5882    ProQ2: 0.0046       
Pseudo-energy (x10^4 J): GOAP: -1.1478    DFIRE: -0.8113
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 13
(Zhang-Server_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: n/a    MQAPmulti: 0.7999    
Single model MQAPs (GDT_TS):  MQAPsingle: n/a    MetaMQAP: 0.5798    ProQ2: n/a       
Pseudo-energy (x10^4 J): GOAP: -1.2918    DFIRE: -0.9231
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 14
(RaptorX_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6562    MQAPmulti: 0.7501    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6093    MetaMQAP: 0.5756    ProQ2: 0.4149       
Pseudo-energy (x10^4 J): GOAP: -1.1166    DFIRE: -0.8419
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 15
(RaptorX-MSA_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7133    MQAPmulti: 0.7786    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6079    MetaMQAP: 0.5756    ProQ2: 0.4382       
Pseudo-energy (x10^4 J): GOAP: -1.2731    DFIRE: -0.8736
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 16
(RaptorX-Boost_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6562    MQAPmulti: 0.7501    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6093    MetaMQAP: 0.5756    ProQ2: 0.4149       
Pseudo-energy (x10^4 J): GOAP: -1.1166    DFIRE: -0.8419
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 17
(Jiang_Assembly_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6605    MQAPmulti: 0.7490    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5696    MetaMQAP: 0.5714    ProQ2: 0.4121       
Pseudo-energy (x10^4 J): GOAP: -1.2478    DFIRE: -0.8685
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 18
(ZHOU-SPARKS-X_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7000    MQAPmulti: 0.7491    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5995    MetaMQAP: 0.5693    ProQ2: 0.4075       
Pseudo-energy (x10^4 J): GOAP: -1.3126    DFIRE: -0.9023
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 19
(Zhang-Server_TS4)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7088    MQAPmulti: 0.7196    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5940    MetaMQAP: 0.5693    ProQ2: 0.3539       
Pseudo-energy (x10^4 J): GOAP: -1.1927    DFIRE: -0.8781
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 20
(BAKER-ROSETTASERVER_TS3)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6275    MQAPmulti: 0.7473    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5757    MetaMQAP: 0.5651    ProQ2: 0.3573       
Pseudo-energy (x10^4 J): GOAP: -1.3295    DFIRE: -0.8845
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


Valid HTML 4.01!