QA-RecombineIt results for job id CASP_T0523_140916UgX7oc

QA: quality assessment mode.

Summary

Here are the results of the QA mode, in which our server calculated quality assessment of the submitted models.

The models presented here are ordered according to the MQAPcomb global score. Rank models by: MQAPmulti MQAPsingle MetaMQAP ProQ2 GOAP DFIRE .
The number of the best models presented here is 20. Display different number of models: 5 10 50 .
The local model quality along the sequence is based on the MQAPcomb local score. Choose another score of local model quality: MetaMQAP MQAPmulti ProQ2 MQAPsingle

Please note that this website has been tested and optimized for Mozilla, Firefox, Opera, and Chrome.

Tools

RecombineIt submission, basic mode

In this basic mode, RecombineIt will create models similar to at least one of the 5 initial models ranked the best by MQAPcomb.

Fragments for merging will be selected according to the local quality predicted by MQAPcomb.

Sequence 1D information

Here, you can find PREDICTED secondary structure, solvent accessibility and protein order. The predictions were performed for the submitted target sequence.

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structue
Solvent Accessibility
Protein Order

Model quality assessment

This section presents the Quality Assessment of the models submitted by you.
These models are ordered according to the MQAPcomb global score. The top model is the one with the highest predicted global accuracy.
Also the local model accuracy, as the MQAPcomb score, is presented as a heat map. The colors correspond to the local error expressed in Angstrom.
Colors are in the range from BLUE: 0 Angstroms to RED: 8 Angstroms and more.

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
 
MODEL NAME
glob: MQAPcomb
 loc: MQAPcomb: 0Å 
 
 8Å
 
0.780    0.800
0.764    0.774
0.756    0.790
0.740    0.774
0.739    0.800
0.733    0.800
0.731    0.800
0.728    0.800
0.727    0.800
0.725    0.755
0.717    0.760
0.717    0.760
0.717    0.760
0.713    0.779
0.710    0.754
0.709    0.720
0.700    0.749
0.698    0.776
0.697    0.735
0.691    0.800

Detailed information

BEST MODEL 1
(QUARK_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7803    MQAPmulti: 0.7999    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6095    MetaMQAP: 0.5315    ProQ2: 0.4421       
Pseudo-energy (x10^4 J): GOAP: -1.3135    DFIRE: -0.9186
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPcomb: 0Å 
 
 8Å

 


BEST MODEL 2
(RaptorX-Boost_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7641    MQAPmulti: 0.7739    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6207    MetaMQAP: 0.6513    ProQ2: 0.4409       
Pseudo-energy (x10^4 J): GOAP: -1.2206    DFIRE: -0.8668
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPcomb: 0Å 
 
 8Å

 


BEST MODEL 3
(Jiang_Assembly_TS4)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7564    MQAPmulti: 0.7896    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5920    MetaMQAP: 0.5420    ProQ2: 0.4681       
Pseudo-energy (x10^4 J): GOAP: -1.2664    DFIRE: -0.8724
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPcomb: 0Å 
 
 8Å

 


BEST MODEL 4
(RaptorX_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7399    MQAPmulti: 0.7739    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6229    MetaMQAP: 0.6954    ProQ2: 0.4409       
Pseudo-energy (x10^4 J): GOAP: -1.2206    DFIRE: -0.8668
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPcomb: 0Å 
 
 8Å

 


BEST MODEL 5
(Zhang-Server_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7390    MQAPmulti: 0.7998    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5484    MetaMQAP: 0.5945    ProQ2: 0.0045       
Pseudo-energy (x10^4 J): GOAP: -1.2648    DFIRE: -0.8992
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPcomb: 0Å 
 
 8Å

 


BEST MODEL 6
(Zhang-Server_TS3)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7327    MQAPmulti: 0.7998    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5867    MetaMQAP: 0.5294    ProQ2: 0.3973       
Pseudo-energy (x10^4 J): GOAP: -1.1991    DFIRE: -0.8974
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPcomb: 0Å 
 
 8Å

 


BEST MODEL 7
(BAKER-ROSETTASERVER_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7309    MQAPmulti: 0.7996    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5827    MetaMQAP: 0.5924    ProQ2: 0.4423       
Pseudo-energy (x10^4 J): GOAP: -1.4636    DFIRE: -0.8990
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPcomb: 0Å 
 
 8Å

 


BEST MODEL 8
(Jiang_Assembly_TS3)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7276    MQAPmulti: 0.7998    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5867    MetaMQAP: 0.5525    ProQ2: 0.4190       
Pseudo-energy (x10^4 J): GOAP: -1.2307    DFIRE: -0.8602
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPcomb: 0Å 
 
 8Å

 


BEST MODEL 9
(Jiang_THREADER_TS5)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7270    MQAPmulti: 0.7998    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5860    MetaMQAP: 0.5378    ProQ2: 0.4190       
Pseudo-energy (x10^4 J): GOAP: -1.2307    DFIRE: -0.8602
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPcomb: 0Å 
 
 8Å

 


BEST MODEL 10
(chunk-TASSER_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7248    MQAPmulti: 0.7552    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5987    MetaMQAP: 0.4790    ProQ2: 0.3627       
Pseudo-energy (x10^4 J): GOAP: -0.9892    DFIRE: -0.8459
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPcomb: 0Å 
 
 8Å

 


BEST MODEL 11
(HHpredB_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7170    MQAPmulti: 0.7601    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6086    MetaMQAP: 0.5483    ProQ2: 0.3673       
Pseudo-energy (x10^4 J): GOAP: -1.2729    DFIRE: -0.8496
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPcomb: 0Å 
 
 8Å

 


BEST MODEL 12
(HHpredA_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7169    MQAPmulti: 0.7601    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6084    MetaMQAP: 0.5441    ProQ2: 0.3673       
Pseudo-energy (x10^4 J): GOAP: -1.2729    DFIRE: -0.8496
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPcomb: 0Å 
 
 8Å

 


BEST MODEL 13
(HHpredC_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7167    MQAPmulti: 0.7601    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6082    MetaMQAP: 0.5399    ProQ2: 0.3673       
Pseudo-energy (x10^4 J): GOAP: -1.2729    DFIRE: -0.8496
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPcomb: 0Å 
 
 8Å

 


BEST MODEL 14
(RaptorX-MSA_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7133    MQAPmulti: 0.7786    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6079    MetaMQAP: 0.5756    ProQ2: 0.4382       
Pseudo-energy (x10^4 J): GOAP: -1.2731    DFIRE: -0.8736
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPcomb: 0Å 
 
 8Å

 


BEST MODEL 15
(chunk-TASSER_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7097    MQAPmulti: 0.7537    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5776    MetaMQAP: 0.3802    ProQ2: 0.3264       
Pseudo-energy (x10^4 J): GOAP: -0.8559    DFIRE: -0.8063
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPcomb: 0Å 
 
 8Å

 


BEST MODEL 16
(Zhang-Server_TS4)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7088    MQAPmulti: 0.7196    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5940    MetaMQAP: 0.5693    ProQ2: 0.3539       
Pseudo-energy (x10^4 J): GOAP: -1.1927    DFIRE: -0.8781
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPcomb: 0Å 
 
 8Å

 


BEST MODEL 17
(ZHOU-SPARKS-X_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7000    MQAPmulti: 0.7491    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5995    MetaMQAP: 0.5693    ProQ2: 0.4075       
Pseudo-energy (x10^4 J): GOAP: -1.3126    DFIRE: -0.9023
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPcomb: 0Å 
 
 8Å

 


BEST MODEL 18
(ZHOU-SPARKS-X_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6979    MQAPmulti: 0.7756    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5880    MetaMQAP: 0.6555    ProQ2: 0.4647       
Pseudo-energy (x10^4 J): GOAP: -1.2618    DFIRE: -0.8814
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPcomb: 0Å 
 
 8Å

 


BEST MODEL 19
(IntFOLD-TS_TS4)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6970    MQAPmulti: 0.7354    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5770    MetaMQAP: 0.5525    ProQ2: 0.3867       
Pseudo-energy (x10^4 J): GOAP: -1.1497    DFIRE: -0.8515
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPcomb: 0Å 
 
 8Å

 


BEST MODEL 20
(QUARK_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6910    MQAPmulti: 0.7998    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5877    MetaMQAP: 0.5924    ProQ2: 0.4261       
Pseudo-energy (x10^4 J): GOAP: -1.2394    DFIRE: -0.9088
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPcomb: 0Å 
 
 8Å

 


Valid HTML 4.01!