QA-RecombineIt results for job id CASP_T0523_140916UgX7oc

QA: quality assessment mode.

Summary

Here are the results of the QA mode, in which our server calculated quality assessment of the submitted models.

The models presented here are ordered according to the MetaMQAP global score. Rank models by: MQAPcomb MQAPmulti MQAPsingle ProQ2 GOAP DFIRE .
The number of the best models presented here is 5. Display different number of models: 10 20 50 .
The local model quality along the sequence is based on the ProQ2 local score. Choose another score of local model quality: MQAPcomb MetaMQAP MQAPmulti MQAPsingle

Please note that this website has been tested and optimized for Mozilla, Firefox, Opera, and Chrome.

Tools

RecombineIt submission, basic mode

In this basic mode, RecombineIt will create models similar to at least one of the 5 initial models ranked the best by MetaMQAP.

Fragments for merging will be selected according to the local quality predicted by ProQ2.

Sequence 1D information

Here, you can find PREDICTED secondary structure, solvent accessibility and protein order. The predictions were performed for the submitted target sequence.

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structue
Solvent Accessibility
Protein Order

Model quality assessment

This section presents the Quality Assessment of the models submitted by you.
These models are ordered according to the MetaMQAP global score. The top model is the one with the highest predicted global accuracy.
Also the local model accuracy, as the ProQ2 score, is presented as a heat map. The colors correspond to the local error expressed in Angstrom.
Colors are in the range from BLUE: 0 Angstroms to RED: 8 Angstroms and more.

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
 
MODEL NAME
glob: MetaMQAP
 loc: ProQ2: 0Å 
 
 8Å
 
0.700    0.662
0.695    0.740
0.670    n/a
0.662    0.661
0.655    0.698

Detailed information

BEST MODEL 1
(IntFOLD-TS_TS3)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6624    MQAPmulti: 0.7347    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5907    MetaMQAP: 0.6996    ProQ2: 0.4149       
Pseudo-energy (x10^4 J): GOAP: -1.3647    DFIRE: -0.9205
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
ProQ2: 0Å 
 
 8Å

 


BEST MODEL 2
(RaptorX_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7399    MQAPmulti: 0.7739    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6229    MetaMQAP: 0.6954    ProQ2: 0.4409       
Pseudo-energy (x10^4 J): GOAP: -1.2206    DFIRE: -0.8668
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
ProQ2: 0Å 
 
 8Å

 


BEST MODEL 3
(BAKER-ROSETTASERVER_TS4)
Clustering MQAPs (GDT_TS) :  MQAPcomb: n/a    MQAPmulti: 0.7552    
Single model MQAPs (GDT_TS):  MQAPsingle: n/a    MetaMQAP: 0.6702    ProQ2: n/a       
Pseudo-energy (x10^4 J): GOAP: -1.4674    DFIRE: -0.9566
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
ProQ2: 0Å 
 
 8Å

 


BEST MODEL 4
(IntFOLD-TS_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6609    MQAPmulti: 0.7347    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5888    MetaMQAP: 0.6618    ProQ2: 0.4149       
Pseudo-energy (x10^4 J): GOAP: -1.3647    DFIRE: -0.9205
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
ProQ2: 0Å 
 
 8Å

 


BEST MODEL 5
(ZHOU-SPARKS-X_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6979    MQAPmulti: 0.7756    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5880    MetaMQAP: 0.6555    ProQ2: 0.4647       
Pseudo-energy (x10^4 J): GOAP: -1.2618    DFIRE: -0.8814
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
ProQ2: 0Å 
 
 8Å

 


Valid HTML 4.01!