QA-RecombineIt results for job id CASP_T0523_140916UgX7oc

QA: quality assessment mode.

Summary

Here are the results of the QA mode, in which our server calculated quality assessment of the submitted models.

The models presented here are ordered according to the MQAPcomb global score. Rank models by: MQAPmulti MQAPsingle MetaMQAP ProQ2 GOAP DFIRE .
The number of the best models presented here is 50. Display different number of models: 5 10 20 .
The local model quality along the sequence is based on the MetaMQAP local score. Choose another score of local model quality: MQAPcomb MQAPmulti ProQ2 MQAPsingle

Please note that this website has been tested and optimized for Mozilla, Firefox, Opera, and Chrome.

Tools

RecombineIt submission, basic mode

In this basic mode, RecombineIt will create models similar to at least one of the 5 initial models ranked the best by MQAPcomb.

Fragments for merging will be selected according to the local quality predicted by MetaMQAP.

Sequence 1D information

Here, you can find PREDICTED secondary structure, solvent accessibility and protein order. The predictions were performed for the submitted target sequence.

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structue
Solvent Accessibility
Protein Order

Model quality assessment

This section presents the Quality Assessment of the models submitted by you.
These models are ordered according to the MQAPcomb global score. The top model is the one with the highest predicted global accuracy.
Also the local model accuracy, as the MetaMQAP score, is presented as a heat map. The colors correspond to the local error expressed in Angstrom.
Colors are in the range from BLUE: 0 Angstroms to RED: 8 Angstroms and more.

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
 
MODEL NAME
glob: MQAPcomb
 loc: MetaMQAP: 0Å 
 
 8Å
 
0.780    0.800
0.764    0.774
0.756    0.790
0.740    0.774
0.739    0.800
0.733    0.800
0.731    0.800
0.728    0.800
0.727    0.800
0.725    0.755
0.717    0.760
0.717    0.760
0.717    0.760
0.713    0.779
0.710    0.754
0.709    0.720
0.700    0.749
0.698    0.776
0.697    0.735
0.691    0.800
0.678    0.755
0.674    0.692
0.662    0.764
0.662    0.735
0.661    0.735
0.660    0.749
0.656    0.750
0.656    0.750
0.645    0.747
0.637    0.692
0.636    0.707
0.630    0.723
0.627    0.747
0.624    0.721
0.610    0.711
0.591    0.678
0.587    0.715
0.580    0.705
0.576    0.677
0.566    0.691
0.557    0.699
0.556    0.708
0.552    0.702
0.550    0.711
0.539    0.644
0.534    0.708
0.516    0.649
0.503    0.646
0.236    0.353
0.166    0.328

Detailed information

BEST MODEL 1
(QUARK_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7803    MQAPmulti: 0.7999    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6095    MetaMQAP: 0.5315    ProQ2: 0.4421       
Pseudo-energy (x10^4 J): GOAP: -1.3135    DFIRE: -0.9186
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 2
(RaptorX-Boost_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7641    MQAPmulti: 0.7739    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6207    MetaMQAP: 0.6513    ProQ2: 0.4409       
Pseudo-energy (x10^4 J): GOAP: -1.2206    DFIRE: -0.8668
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 3
(Jiang_Assembly_TS4)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7564    MQAPmulti: 0.7896    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5920    MetaMQAP: 0.5420    ProQ2: 0.4681       
Pseudo-energy (x10^4 J): GOAP: -1.2664    DFIRE: -0.8724
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 4
(RaptorX_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7399    MQAPmulti: 0.7739    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6229    MetaMQAP: 0.6954    ProQ2: 0.4409       
Pseudo-energy (x10^4 J): GOAP: -1.2206    DFIRE: -0.8668
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 5
(Zhang-Server_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7390    MQAPmulti: 0.7998    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5484    MetaMQAP: 0.5945    ProQ2: 0.0045       
Pseudo-energy (x10^4 J): GOAP: -1.2648    DFIRE: -0.8992
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 6
(Zhang-Server_TS3)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7327    MQAPmulti: 0.7998    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5867    MetaMQAP: 0.5294    ProQ2: 0.3973       
Pseudo-energy (x10^4 J): GOAP: -1.1991    DFIRE: -0.8974
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 7
(BAKER-ROSETTASERVER_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7309    MQAPmulti: 0.7996    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5827    MetaMQAP: 0.5924    ProQ2: 0.4423       
Pseudo-energy (x10^4 J): GOAP: -1.4636    DFIRE: -0.8990
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 8
(Jiang_Assembly_TS3)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7276    MQAPmulti: 0.7998    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5867    MetaMQAP: 0.5525    ProQ2: 0.4190       
Pseudo-energy (x10^4 J): GOAP: -1.2307    DFIRE: -0.8602
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 9
(Jiang_THREADER_TS5)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7270    MQAPmulti: 0.7998    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5860    MetaMQAP: 0.5378    ProQ2: 0.4190       
Pseudo-energy (x10^4 J): GOAP: -1.2307    DFIRE: -0.8602
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 10
(chunk-TASSER_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7248    MQAPmulti: 0.7552    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5987    MetaMQAP: 0.4790    ProQ2: 0.3627       
Pseudo-energy (x10^4 J): GOAP: -0.9892    DFIRE: -0.8459
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 11
(HHpredB_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7170    MQAPmulti: 0.7601    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6086    MetaMQAP: 0.5483    ProQ2: 0.3673       
Pseudo-energy (x10^4 J): GOAP: -1.2729    DFIRE: -0.8496
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 12
(HHpredA_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7169    MQAPmulti: 0.7601    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6084    MetaMQAP: 0.5441    ProQ2: 0.3673       
Pseudo-energy (x10^4 J): GOAP: -1.2729    DFIRE: -0.8496
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 13
(HHpredC_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7167    MQAPmulti: 0.7601    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6082    MetaMQAP: 0.5399    ProQ2: 0.3673       
Pseudo-energy (x10^4 J): GOAP: -1.2729    DFIRE: -0.8496
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 14
(RaptorX-MSA_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7133    MQAPmulti: 0.7786    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6079    MetaMQAP: 0.5756    ProQ2: 0.4382       
Pseudo-energy (x10^4 J): GOAP: -1.2731    DFIRE: -0.8736
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 15
(chunk-TASSER_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7097    MQAPmulti: 0.7537    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5776    MetaMQAP: 0.3802    ProQ2: 0.3264       
Pseudo-energy (x10^4 J): GOAP: -0.8559    DFIRE: -0.8063
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 16
(Zhang-Server_TS4)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7088    MQAPmulti: 0.7196    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5940    MetaMQAP: 0.5693    ProQ2: 0.3539       
Pseudo-energy (x10^4 J): GOAP: -1.1927    DFIRE: -0.8781
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 17
(ZHOU-SPARKS-X_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7000    MQAPmulti: 0.7491    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5995    MetaMQAP: 0.5693    ProQ2: 0.4075       
Pseudo-energy (x10^4 J): GOAP: -1.3126    DFIRE: -0.9023
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 18
(ZHOU-SPARKS-X_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6979    MQAPmulti: 0.7756    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5880    MetaMQAP: 0.6555    ProQ2: 0.4647       
Pseudo-energy (x10^4 J): GOAP: -1.2618    DFIRE: -0.8814
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 19
(IntFOLD-TS_TS4)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6970    MQAPmulti: 0.7354    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5770    MetaMQAP: 0.5525    ProQ2: 0.3867       
Pseudo-energy (x10^4 J): GOAP: -1.1497    DFIRE: -0.8515
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 20
(QUARK_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6910    MQAPmulti: 0.7998    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5877    MetaMQAP: 0.5924    ProQ2: 0.4261       
Pseudo-energy (x10^4 J): GOAP: -1.2394    DFIRE: -0.9088
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 21
(IntFOLD-TS_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6778    MQAPmulti: 0.7545    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5779    MetaMQAP: 0.4958    ProQ2: 0.3176       
Pseudo-energy (x10^4 J): GOAP: -1.2640    DFIRE: -0.8763
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 22
(Jiang_THREADER_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6735    MQAPmulti: 0.6919    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5518    MetaMQAP: 0.5525    ProQ2: 0.3891       
Pseudo-energy (x10^4 J): GOAP: -1.1478    DFIRE: -0.8113
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 23
(Jiang_Assembly_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6625    MQAPmulti: 0.7635    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5700    MetaMQAP: 0.5168    ProQ2: 0.3608       
Pseudo-energy (x10^4 J): GOAP: -1.2466    DFIRE: -0.8656
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 24
(IntFOLD-TS_TS3)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6624    MQAPmulti: 0.7347    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5907    MetaMQAP: 0.6996    ProQ2: 0.4149       
Pseudo-energy (x10^4 J): GOAP: -1.3647    DFIRE: -0.9205
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 25
(IntFOLD-TS_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6609    MQAPmulti: 0.7347    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5888    MetaMQAP: 0.6618    ProQ2: 0.4149       
Pseudo-energy (x10^4 J): GOAP: -1.3647    DFIRE: -0.9205
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 26
(Jiang_Assembly_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6605    MQAPmulti: 0.7490    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5696    MetaMQAP: 0.5714    ProQ2: 0.4121       
Pseudo-energy (x10^4 J): GOAP: -1.2478    DFIRE: -0.8685
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 27
(RaptorX_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6562    MQAPmulti: 0.7501    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6093    MetaMQAP: 0.5756    ProQ2: 0.4149       
Pseudo-energy (x10^4 J): GOAP: -1.1166    DFIRE: -0.8419
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 28
(RaptorX-Boost_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6562    MQAPmulti: 0.7501    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6093    MetaMQAP: 0.5756    ProQ2: 0.4149       
Pseudo-energy (x10^4 J): GOAP: -1.1166    DFIRE: -0.8419
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 29
(RaptorX-MSA_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6455    MQAPmulti: 0.7468    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5977    MetaMQAP: 0.6429    ProQ2: 0.4150       
Pseudo-energy (x10^4 J): GOAP: -1.2632    DFIRE: -0.8817
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 30
(Jiang_Assembly_TS5)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6365    MQAPmulti: 0.6919    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5055    MetaMQAP: 0.5882    ProQ2: 0.0046       
Pseudo-energy (x10^4 J): GOAP: -1.1478    DFIRE: -0.8113
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 31
(QUARK_TS3)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6359    MQAPmulti: 0.7070    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5884    MetaMQAP: 0.5399    ProQ2: 0.3700       
Pseudo-energy (x10^4 J): GOAP: -1.2306    DFIRE: -0.8822
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 32
(BAKER-ROSETTASERVER_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6302    MQAPmulti: 0.7233    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5851    MetaMQAP: 0.5987    ProQ2: 0.4362       
Pseudo-energy (x10^4 J): GOAP: -1.2597    DFIRE: -0.8931
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 33
(BAKER-ROSETTASERVER_TS3)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6275    MQAPmulti: 0.7473    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5757    MetaMQAP: 0.5651    ProQ2: 0.3573       
Pseudo-energy (x10^4 J): GOAP: -1.3295    DFIRE: -0.8845
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 34
(IntFOLD-TS_TS5)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6244    MQAPmulti: 0.7215    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5908    MetaMQAP: 0.5357    ProQ2: 0.4123       
Pseudo-energy (x10^4 J): GOAP: -1.2750    DFIRE: -0.8521
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 35
(chunk-TASSER_TS5)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6097    MQAPmulti: 0.7107    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5254    MetaMQAP: 0.3592    ProQ2: 0.1332       
Pseudo-energy (x10^4 J): GOAP: -0.8551    DFIRE: -0.8145
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 36
(ZHOU-SPARKS-X_TS4)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.5911    MQAPmulti: 0.6780    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5223    MetaMQAP: 0.3950    ProQ2: 0.3001       
Pseudo-energy (x10^4 J): GOAP: -1.0537    DFIRE: -0.8335
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 37
(chunk-TASSER_TS3)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.5865    MQAPmulti: 0.7151    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5492    MetaMQAP: 0.4055    ProQ2: 0.2402       
Pseudo-energy (x10^4 J): GOAP: -0.8562    DFIRE: -0.8445
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 38
(GSmetaserver_TS5)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.5803    MQAPmulti: 0.7048    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5877    MetaMQAP: 0.5609    ProQ2: 0.3901       
Pseudo-energy (x10^4 J): GOAP: -1.0590    DFIRE: -0.8182
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 39
(ZHOU-SPARKS-X_TS5)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.5759    MQAPmulti: 0.6769    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5385    MetaMQAP: 0.5063    ProQ2: 0.3361       
Pseudo-energy (x10^4 J): GOAP: -1.0703    DFIRE: -0.8782
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 40
(ZHOU-SPARKS-X_TS3)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.5661    MQAPmulti: 0.6911    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5161    MetaMQAP: 0.3361    ProQ2: 0.3286       
Pseudo-energy (x10^4 J): GOAP: -1.0953    DFIRE: -0.8775
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 41
(chunk-TASSER_TS4)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.5575    MQAPmulti: 0.6990    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5233    MetaMQAP: 0.3277    ProQ2: 0.1933       
Pseudo-energy (x10^4 J): GOAP: -0.8777    DFIRE: -0.8105
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 42
(GSmetaserver_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.5562    MQAPmulti: 0.7082    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5775    MetaMQAP: 0.5042    ProQ2: 0.3620       
Pseudo-energy (x10^4 J): GOAP: -1.0886    DFIRE: -0.7793
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 43
(GSmetaserver_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.5522    MQAPmulti: 0.7019    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5902    MetaMQAP: 0.5336    ProQ2: 0.4081       
Pseudo-energy (x10^4 J): GOAP: -1.1054    DFIRE: -0.8324
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 44
(GSmetaserver_TS3)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.5503    MQAPmulti: 0.7114    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5754    MetaMQAP: 0.4937    ProQ2: 0.3575       
Pseudo-energy (x10^4 J): GOAP: -1.0790    DFIRE: -0.7835
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 45
(Jiang_THREADER_TS4)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.5385    MQAPmulti: 0.6441    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.4786    MetaMQAP: 0.5231    ProQ2: 0.3383       
Pseudo-energy (x10^4 J): GOAP: -1.0135    DFIRE: -0.8178
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 46
(GSmetaserver_TS4)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.5340    MQAPmulti: 0.7085    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5678    MetaMQAP: 0.5063    ProQ2: 0.3267       
Pseudo-energy (x10^4 J): GOAP: -1.0916    DFIRE: -0.7780
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 47
(Jiang_THREADER_TS3)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.5163    MQAPmulti: 0.6492    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.4574    MetaMQAP: 0.4622    ProQ2: 0.2874       
Pseudo-energy (x10^4 J): GOAP: -0.8935    DFIRE: -0.7987
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 48
(BAKER-ROSETTASERVER_TS5)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.5028    MQAPmulti: 0.6458    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5108    MetaMQAP: 0.5420    ProQ2: 0.3426       
Pseudo-energy (x10^4 J): GOAP: -1.1001    DFIRE: -0.9195
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 49
(QUARK_TS4)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.2358    MQAPmulti: 0.3529    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.3302    MetaMQAP: 0.4202    ProQ2: 0.3314       
Pseudo-energy (x10^4 J): GOAP: -0.7151    DFIRE: -0.8586
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 50
(QUARK_TS5)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.1661    MQAPmulti: 0.3282    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.2877    MetaMQAP: 0.1996    ProQ2: 0.1534       
Pseudo-energy (x10^4 J): GOAP: -0.5389    DFIRE: -0.7150
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


Valid HTML 4.01!