QA-RecombineIt results for job id CASP_T0523_140916UgX7oc

RecombineIt: recombination mode.

Summary

Here are the results of the RecombineIt mode. In this mode our server combines fragments with high predicted accuracy to build new hybrid models with accuracy improved compared to the starting models.
Usually, over 100 millions possible combinations of fragments are tested, then 100 final models are built by the MODELLER program.

The models presented here are ordered according to the DFIRE global score. Rank models by: MQAPcomb MQAPmulti MQAPsingle MetaMQAP ProQ2 GOAP .
The number of the best models presented here is 10. Display different number of models: 5 20 50 .
The local model quality along the sequence is based on the MetaMQAP local score. Choose another score of local model quality: MQAPcomb MQAPmulti ProQ2 MQAPsingle

Please note that this website has been tested and optimized for Mozilla, Firefox, Opera, and Chrome.

Tools

Sequence 1D information

Here, you can find PREDICTED secondary structure, solvent accessibility and protein order. The predictions were performed for the submitted target sequence.

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structue
Solvent Accessibility
Protein Order

Model quality assessment

This section presents the Quality Assessment of the hybrid models created by our recombination algorithm (RecombineIt) and the 5 highest scored models by MQAPmulti from those submitted by you.
These models are ordered according to the DFIRE global score. The top model is the one with the highest predicted global accuracy.
Also the local model accuracy, as the MetaMQAP score, is presented as a heat map. The colors correspond to the local error expressed in Angstrom.
Colors are in the range from BLUE: 0 Angstroms to RED: 8 Angstroms and more.

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
 
MODEL NAME
glob: DFIRE
 loc: MetaMQAP: 0Å 
 
 8Å
 
-0.936    0.797
-0.934    0.823
-0.933    0.706
-0.932    0.786
-0.930    0.803
-0.928    0.769
-0.928    0.841
-0.928    0.830
-0.927    0.817
-0.927    0.777

Model fragments

The RecombineIt algorithm has sampled several milions of possible combinations of the fragments derived from your input models.
For the 100 most promissing combinations, the MODELLER program created models of the target protein.
Here, we present these models composition. Every fragment is named according to the initial models it comes from.

Fragment cloud - the greater the font size, the more often the fragments derived from a given initial models were used to build the hybrid models presented here.
BAKER-ROSETTASERVER_TS4 QUARK_TS1 QUARK_TS2 Zhang-Server_TS1 Zhang-Server_TS2 chunk-TASSER_TS1 chunk-TASSER_TS2 chunk-TASSER_TS5 
Sequence
Fragment definition
 
MODEL NAME
glob: DFIRE
 
Below, the fragments boundaries are presented
 
-0.936    0.797
                                                                                                                        
-0.934    0.823
                                                                                                                        
-0.933    0.706
                                                                                                                        
-0.932    0.786
                                                                                                                        
-0.930    0.803
                                                                                                                        
-0.928    0.769
                                                                                                                        
-0.928    0.841
                                                                                                                        
-0.928    0.830
                                                                                                                        
-0.927    0.817
                                                                                                                        
-0.927    0.777
                                                                                                                        

Detailed information

BEST MODEL 1
(model_2_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7973    MQAPmulti: 0.8868    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6094    MetaMQAP: 0.5693    ProQ2: 0.4241       
Pseudo-energy (x10^4 J): GOAP: -1.3299    DFIRE: -0.9362
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 2
(model_35_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8234    MQAPmulti: 0.8846    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6142    MetaMQAP: 0.5483    ProQ2: 0.4644       
Pseudo-energy (x10^4 J): GOAP: -1.3423    DFIRE: -0.9341
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 3
(model_66_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7061    MQAPmulti: 0.8071    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5870    MetaMQAP: 0.5462    ProQ2: 0.3831       
Pseudo-energy (x10^4 J): GOAP: -1.2327    DFIRE: -0.9325
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 4
(model_36_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7857    MQAPmulti: 0.8870    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6025    MetaMQAP: 0.5357    ProQ2: 0.4062       
Pseudo-energy (x10^4 J): GOAP: -1.3390    DFIRE: -0.9316
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 5
(model_41_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8025    MQAPmulti: 0.8875    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6077    MetaMQAP: 0.5483    ProQ2: 0.4255       
Pseudo-energy (x10^4 J): GOAP: -1.3286    DFIRE: -0.9298
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 6
(model_37_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7692    MQAPmulti: 0.8863    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5960    MetaMQAP: 0.5189    ProQ2: 0.3718       
Pseudo-energy (x10^4 J): GOAP: -1.3190    DFIRE: -0.9282
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 7
(model_80_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8413    MQAPmulti: 0.8977    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6051    MetaMQAP: 0.5399    ProQ2: 0.4576       
Pseudo-energy (x10^4 J): GOAP: -1.3288    DFIRE: -0.9280
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 8
(model_71_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8299    MQAPmulti: 0.8873    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6104    MetaMQAP: 0.5441    ProQ2: 0.4247       
Pseudo-energy (x10^4 J): GOAP: -1.3541    DFIRE: -0.9277
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 9
(model_44_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8167    MQAPmulti: 0.8976    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6033    MetaMQAP: 0.6534    ProQ2: 0.4730       
Pseudo-energy (x10^4 J): GOAP: -1.3327    DFIRE: -0.9271
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 10
(model_10_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7773    MQAPmulti: 0.8821    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5973    MetaMQAP: 0.4979    ProQ2: 0.4259       
Pseudo-energy (x10^4 J): GOAP: -1.3519    DFIRE: -0.9268
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


Valid HTML 4.01!