QA-RecombineIt results for job id CASP_T0523_140916UgX7oc

RecombineIt: recombination mode.

Summary

Here are the results of the RecombineIt mode. In this mode our server combines fragments with high predicted accuracy to build new hybrid models with accuracy improved compared to the starting models.
Usually, over 100 millions possible combinations of fragments are tested, then 100 final models are built by the MODELLER program.

The models presented here are ordered according to the MetaMQAP global score. Rank models by: MQAPcomb MQAPmulti MQAPsingle ProQ2 GOAP DFIRE .
The number of the best models presented here is 10. Display different number of models: 5 20 50 .
The local model quality along the sequence is based on the MetaMQAP local score. Choose another score of local model quality: MQAPcomb MQAPmulti ProQ2 MQAPsingle

Please note that this website has been tested and optimized for Mozilla, Firefox, Opera, and Chrome.

Tools

Sequence 1D information

Here, you can find PREDICTED secondary structure, solvent accessibility and protein order. The predictions were performed for the submitted target sequence.

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structue
Solvent Accessibility
Protein Order

Model quality assessment

This section presents the Quality Assessment of the hybrid models created by our recombination algorithm (RecombineIt) and the 5 highest scored models by MQAPmulti from those submitted by you.
These models are ordered according to the MetaMQAP global score. The top model is the one with the highest predicted global accuracy.
Also the local model accuracy, as the MetaMQAP score, is presented as a heat map. The colors correspond to the local error expressed in Angstrom.
Colors are in the range from BLUE: 0 Angstroms to RED: 8 Angstroms and more.

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
 
MODEL NAME
glob: MetaMQAP
 loc: MetaMQAP: 0Å 
 
 8Å
 
0.653    0.817
0.620    0.651
0.601    0.780
0.595    0.671
0.592    0.636
0.588    0.712
0.580    0.777
0.576    0.765
0.569    0.797
0.569    0.817

Model fragments

The RecombineIt algorithm has sampled several milions of possible combinations of the fragments derived from your input models.
For the 100 most promissing combinations, the MODELLER program created models of the target protein.
Here, we present these models composition. Every fragment is named according to the initial models it comes from.

Fragment cloud - the greater the font size, the more often the fragments derived from a given initial models were used to build the hybrid models presented here.
QUARK_TS1 QUARK_TS2 Zhang-Server_TS1 Zhang-Server_TS2 Zhang-Server_TS3 
Sequence
Fragment definition
 
MODEL NAME
glob: MetaMQAP
 
Below, the fragments boundaries are presented
 
0.653    0.817
                                                                                                                        
0.620    0.651
                                                                                                                        
0.601    0.780
                                                                                                                        
0.595    0.671
                                                                                                                        
0.592    0.636
                                                                                                                        
0.588    0.712
                                                                                                                        
0.580    0.777
                                                                                                                        
0.576    0.765
                                                                                                                        
0.569    0.797
                                                                                                                        
0.569    0.817
                                                                                                                        

Detailed information

BEST MODEL 1
(model_44_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8167    MQAPmulti: 0.8976    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6033    MetaMQAP: 0.6534    ProQ2: 0.4730       
Pseudo-energy (x10^4 J): GOAP: -1.3327    DFIRE: -0.9271
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 2
(Zhang-Server_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6507    MQAPmulti: 0.7786    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5998    MetaMQAP: 0.6197    ProQ2: 0.4054       
Pseudo-energy (x10^4 J): GOAP: -1.2648    DFIRE: -0.8992
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 3
(model_68_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7803    MQAPmulti: 0.8607    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5995    MetaMQAP: 0.6008    ProQ2: 0.3933       
Pseudo-energy (x10^4 J): GOAP: -1.2621    DFIRE: -0.9065
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 4
(model_48_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6708    MQAPmulti: 0.7820    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6061    MetaMQAP: 0.5945    ProQ2: 0.4460       
Pseudo-energy (x10^4 J): GOAP: -1.2924    DFIRE: -0.9160
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 5
(QUARK_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6365    MQAPmulti: 0.7768    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5877    MetaMQAP: 0.5924    ProQ2: 0.4261       
Pseudo-energy (x10^4 J): GOAP: -1.2394    DFIRE: -0.9088
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 6
(model_72_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7120    MQAPmulti: 0.8069    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5842    MetaMQAP: 0.5882    ProQ2: 0.3746       
Pseudo-energy (x10^4 J): GOAP: -1.2704    DFIRE: -0.9190
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 7
(Zhang-Server_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7767    MQAPmulti: 0.8882    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6080    MetaMQAP: 0.5798    ProQ2: 0.4022       
Pseudo-energy (x10^4 J): GOAP: -1.2918    DFIRE: -0.9231
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 8
(model_63_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7648    MQAPmulti: 0.8508    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5998    MetaMQAP: 0.5756    ProQ2: 0.4126       
Pseudo-energy (x10^4 J): GOAP: -1.2287    DFIRE: -0.8942
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 9
(model_2_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7973    MQAPmulti: 0.8868    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6094    MetaMQAP: 0.5693    ProQ2: 0.4241       
Pseudo-energy (x10^4 J): GOAP: -1.3299    DFIRE: -0.9362
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 10
(model_33_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8168    MQAPmulti: 0.8876    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6113    MetaMQAP: 0.5693    ProQ2: 0.4428       
Pseudo-energy (x10^4 J): GOAP: -1.3218    DFIRE: -0.9206
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


Valid HTML 4.01!