QA-RecombineIt results for job id CASP_T0523_140916UgX7oc

RecombineIt: recombination mode.

Summary

Here are the results of the RecombineIt mode. In this mode our server combines fragments with high predicted accuracy to build new hybrid models with accuracy improved compared to the starting models.
Usually, over 100 millions possible combinations of fragments are tested, then 100 final models are built by the MODELLER program.

The models presented here are ordered according to the MQAPcomb global score. Rank models by: MQAPmulti MQAPsingle MetaMQAP ProQ2 GOAP DFIRE .
The number of the best models presented here is 20. Display different number of models: 5 10 50 .
The local model quality along the sequence is based on the MetaMQAP local score. Choose another score of local model quality: MQAPcomb MQAPmulti ProQ2 MQAPsingle

Please note that this website has been tested and optimized for Mozilla, Firefox, Opera, and Chrome.

Tools

Sequence 1D information

Here, you can find PREDICTED secondary structure, solvent accessibility and protein order. The predictions were performed for the submitted target sequence.

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structue
Solvent Accessibility
Protein Order

Model quality assessment

This section presents the Quality Assessment of the hybrid models created by our recombination algorithm (RecombineIt) and the 5 highest scored models by MQAPmulti from those submitted by you.
These models are ordered according to the MQAPcomb global score. The top model is the one with the highest predicted global accuracy.
Also the local model accuracy, as the MetaMQAP score, is presented as a heat map. The colors correspond to the local error expressed in Angstrom.
Colors are in the range from BLUE: 0 Angstroms to RED: 8 Angstroms and more.

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
 
MODEL NAME
glob: MQAPcomb
 loc: MetaMQAP: 0Å 
 
 8Å
 
0.841    0.898
0.837    0.898
0.832    0.898
0.831    0.887
0.830    0.887
0.830    0.892
0.827    0.898
0.823    0.885
0.820    0.889
0.818    0.895
0.817    0.888
0.817    0.898
0.813    0.892
0.813    0.892
0.810    0.889
0.809    0.885
0.807    0.891
0.807    0.897
0.805    0.897
0.803    0.888

Model fragments

The RecombineIt algorithm has sampled several milions of possible combinations of the fragments derived from your input models.
For the 100 most promissing combinations, the MODELLER program created models of the target protein.
Here, we present these models composition. Every fragment is named according to the initial models it comes from.

Fragment cloud - the greater the font size, the more often the fragments derived from a given initial models were used to build the hybrid models presented here.
BAKER-ROSETTASERVER_TS4 QUARK_TS1 QUARK_TS2 RaptorX-MSA_TS1 Zhang-Server_TS1 Zhang-Server_TS3 Zhang-Server_TS4 Zhang-Server_TS5 chunk-TASSER_TS1 chunk-TASSER_TS2 chunk-TASSER_TS5 
Sequence
Fragment definition
 
MODEL NAME
glob: MQAPcomb
 
Below, the fragments boundaries are presented
 
0.841    0.898
                                                                                                                        
0.837    0.898
                                                                                                                        
0.832    0.898
                                                                                                                        
0.831    0.887
                                                                                                                        
0.830    0.887
                                                                                                                        
0.830    0.892
                                                                                                                        
0.827    0.898
                                                                                                                        
0.823    0.885
                                                                                                                        
0.820    0.889
                                                                                                                        
0.818    0.895
                                                                                                                        
0.817    0.888
                                                                                                                        
0.817    0.898
                                                                                                                        
0.813    0.892
                                                                                                                        
0.813    0.892
                                                                                                                        
0.810    0.889
                                                                                                                        
0.809    0.885
                                                                                                                        
0.807    0.891
                                                                                                                        
0.807    0.897
                                                                                                                        
0.805    0.897
                                                                                                                        
0.803    0.888
                                                                                                                        

Detailed information

BEST MODEL 1
(model_80_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8413    MQAPmulti: 0.8977    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6051    MetaMQAP: 0.5399    ProQ2: 0.4576       
Pseudo-energy (x10^4 J): GOAP: -1.3288    DFIRE: -0.9280
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 2
(model_59_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8373    MQAPmulti: 0.8976    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6178    MetaMQAP: 0.5189    ProQ2: 0.4261       
Pseudo-energy (x10^4 J): GOAP: -1.3249    DFIRE: -0.9241
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 3
(model_22_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8325    MQAPmulti: 0.8977    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6106    MetaMQAP: 0.5084    ProQ2: 0.3818       
Pseudo-energy (x10^4 J): GOAP: -1.2891    DFIRE: -0.9249
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 4
(model_92_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8311    MQAPmulti: 0.8870    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6070    MetaMQAP: 0.5294    ProQ2: 0.4449       
Pseudo-energy (x10^4 J): GOAP: -1.2933    DFIRE: -0.9262
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 5
(model_71_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8299    MQAPmulti: 0.8873    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6104    MetaMQAP: 0.5441    ProQ2: 0.4247       
Pseudo-energy (x10^4 J): GOAP: -1.3541    DFIRE: -0.9277
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 6
(model_12_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8296    MQAPmulti: 0.8916    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6211    MetaMQAP: 0.5462    ProQ2: 0.3867       
Pseudo-energy (x10^4 J): GOAP: -1.2883    DFIRE: -0.9062
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 7
(model_8_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8269    MQAPmulti: 0.8976    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6238    MetaMQAP: 0.5630    ProQ2: 0.3859       
Pseudo-energy (x10^4 J): GOAP: -1.2960    DFIRE: -0.9151
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 8
(model_35_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8234    MQAPmulti: 0.8846    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6142    MetaMQAP: 0.5483    ProQ2: 0.4644       
Pseudo-energy (x10^4 J): GOAP: -1.3423    DFIRE: -0.9341
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 9
(model_5_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8202    MQAPmulti: 0.8893    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6050    MetaMQAP: 0.5588    ProQ2: 0.4372       
Pseudo-energy (x10^4 J): GOAP: -1.3505    DFIRE: -0.9253
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 10
(model_24_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8179    MQAPmulti: 0.8951    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6227    MetaMQAP: 0.5609    ProQ2: 0.4020       
Pseudo-energy (x10^4 J): GOAP: -1.2739    DFIRE: -0.9119
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 11
(model_33_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8168    MQAPmulti: 0.8876    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6113    MetaMQAP: 0.5693    ProQ2: 0.4428       
Pseudo-energy (x10^4 J): GOAP: -1.3218    DFIRE: -0.9206
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 12
(model_44_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8167    MQAPmulti: 0.8976    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6033    MetaMQAP: 0.6534    ProQ2: 0.4730       
Pseudo-energy (x10^4 J): GOAP: -1.3327    DFIRE: -0.9271
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 13
(model_16_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8133    MQAPmulti: 0.8923    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6094    MetaMQAP: 0.5399    ProQ2: 0.3804       
Pseudo-energy (x10^4 J): GOAP: -1.3063    DFIRE: -0.9108
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 14
(model_6_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8129    MQAPmulti: 0.8921    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6151    MetaMQAP: 0.5399    ProQ2: 0.3667       
Pseudo-energy (x10^4 J): GOAP: -1.2909    DFIRE: -0.9117
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 15
(QUARK_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8100    MQAPmulti: 0.8891    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6086    MetaMQAP: 0.5147    ProQ2: 0.4421       
Pseudo-energy (x10^4 J): GOAP: -1.3135    DFIRE: -0.9186
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 16
(model_29_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8086    MQAPmulti: 0.8848    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6186    MetaMQAP: 0.5567    ProQ2: 0.4009       
Pseudo-energy (x10^4 J): GOAP: -1.2909    DFIRE: -0.9143
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 17
(model_23_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8074    MQAPmulti: 0.8907    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6131    MetaMQAP: 0.5420    ProQ2: 0.3710       
Pseudo-energy (x10^4 J): GOAP: -1.2811    DFIRE: -0.9114
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 18
(model_13_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8066    MQAPmulti: 0.8975    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6175    MetaMQAP: 0.5420    ProQ2: 0.3811       
Pseudo-energy (x10^4 J): GOAP: -1.2887    DFIRE: -0.9123
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 19
(model_15_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8046    MQAPmulti: 0.8971    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6109    MetaMQAP: 0.5336    ProQ2: 0.3735       
Pseudo-energy (x10^4 J): GOAP: -1.3006    DFIRE: -0.9098
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 20
(model_41_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8025    MQAPmulti: 0.8875    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6077    MetaMQAP: 0.5483    ProQ2: 0.4255       
Pseudo-energy (x10^4 J): GOAP: -1.3286    DFIRE: -0.9298
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


Valid HTML 4.01!