QA-RecombineIt results for job id CASP_T0523_140916UgX7oc

RecombineIt: recombination mode.

Summary

Here are the results of the RecombineIt mode. In this mode our server combines fragments with high predicted accuracy to build new hybrid models with accuracy improved compared to the starting models.
Usually, over 100 millions possible combinations of fragments are tested, then 100 final models are built by the MODELLER program.

The models presented here are ordered according to the ProQ2 global score. Rank models by: MQAPcomb MQAPmulti MQAPsingle MetaMQAP GOAP DFIRE .
The number of the best models presented here is 20. Display different number of models: 5 10 50 .
The local model quality along the sequence is based on the MetaMQAP local score. Choose another score of local model quality: MQAPcomb MQAPmulti ProQ2 MQAPsingle

Please note that this website has been tested and optimized for Mozilla, Firefox, Opera, and Chrome.

Tools

Sequence 1D information

Here, you can find PREDICTED secondary structure, solvent accessibility and protein order. The predictions were performed for the submitted target sequence.

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structue
Solvent Accessibility
Protein Order

Model quality assessment

This section presents the Quality Assessment of the hybrid models created by our recombination algorithm (RecombineIt) and the 5 highest scored models by MQAPmulti from those submitted by you.
These models are ordered according to the ProQ2 global score. The top model is the one with the highest predicted global accuracy.
Also the local model accuracy, as the MetaMQAP score, is presented as a heat map. The colors correspond to the local error expressed in Angstrom.
Colors are in the range from BLUE: 0 Angstroms to RED: 8 Angstroms and more.

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
 
MODEL NAME
glob: ProQ2
 loc: MetaMQAP: 0Å 
 
 8Å
 
0.473    0.817
0.464    0.823
0.458    0.841
0.446    0.671
0.445    0.831
0.443    0.817
0.442    0.810
0.439    0.796
0.437    0.820
0.434    0.799
0.433    0.612
0.429    0.683
0.427    0.761
0.426    0.837
0.426    0.636
0.426    0.777
0.425    0.803
0.425    0.830
0.424    0.797
0.423    0.801

Model fragments

The RecombineIt algorithm has sampled several milions of possible combinations of the fragments derived from your input models.
For the 100 most promissing combinations, the MODELLER program created models of the target protein.
Here, we present these models composition. Every fragment is named according to the initial models it comes from.

Fragment cloud - the greater the font size, the more often the fragments derived from a given initial models were used to build the hybrid models presented here.
BAKER-ROSETTASERVER_TS4 QUARK_TS1 QUARK_TS2 QUARK_TS3 RaptorX-MSA_TS1 Zhang-Server_TS1 Zhang-Server_TS2 Zhang-Server_TS3 Zhang-Server_TS5 chunk-TASSER_TS1 chunk-TASSER_TS3 chunk-TASSER_TS4 chunk-TASSER_TS5 
Sequence
Fragment definition
 
MODEL NAME
glob: ProQ2
 
Below, the fragments boundaries are presented
 
0.473    0.817
                                                                                                                        
0.464    0.823
                                                                                                                        
0.458    0.841
                                                                                                                        
0.446    0.671
                                                                                                                        
0.445    0.831
                                                                                                                        
0.443    0.817
                                                                                                                        
0.442    0.810
                                                                                                                        
0.439    0.796
                                                                                                                        
0.437    0.820
                                                                                                                        
0.434    0.799
                                                                                                                        
0.433    0.612
                                                                                                                        
0.429    0.683
                                                                                                                        
0.427    0.761
                                                                                                                        
0.426    0.837
                                                                                                                        
0.426    0.636
                                                                                                                        
0.426    0.777
                                                                                                                        
0.425    0.803
                                                                                                                        
0.425    0.830
                                                                                                                        
0.424    0.797
                                                                                                                        
0.423    0.801
                                                                                                                        

Detailed information

BEST MODEL 1
(model_44_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8167    MQAPmulti: 0.8976    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6033    MetaMQAP: 0.6534    ProQ2: 0.4730       
Pseudo-energy (x10^4 J): GOAP: -1.3327    DFIRE: -0.9271
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 2
(model_35_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8234    MQAPmulti: 0.8846    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6142    MetaMQAP: 0.5483    ProQ2: 0.4644       
Pseudo-energy (x10^4 J): GOAP: -1.3423    DFIRE: -0.9341
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 3
(model_80_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8413    MQAPmulti: 0.8977    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6051    MetaMQAP: 0.5399    ProQ2: 0.4576       
Pseudo-energy (x10^4 J): GOAP: -1.3288    DFIRE: -0.9280
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 4
(model_48_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6708    MQAPmulti: 0.7820    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6061    MetaMQAP: 0.5945    ProQ2: 0.4460       
Pseudo-energy (x10^4 J): GOAP: -1.2924    DFIRE: -0.9160
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 5
(model_92_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8311    MQAPmulti: 0.8870    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6070    MetaMQAP: 0.5294    ProQ2: 0.4449       
Pseudo-energy (x10^4 J): GOAP: -1.2933    DFIRE: -0.9262
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 6
(model_33_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8168    MQAPmulti: 0.8876    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6113    MetaMQAP: 0.5693    ProQ2: 0.4428       
Pseudo-energy (x10^4 J): GOAP: -1.3218    DFIRE: -0.9206
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 7
(QUARK_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8100    MQAPmulti: 0.8891    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6086    MetaMQAP: 0.5147    ProQ2: 0.4421       
Pseudo-energy (x10^4 J): GOAP: -1.3135    DFIRE: -0.9186
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 8
(model_55_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7964    MQAPmulti: 0.8866    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6072    MetaMQAP: 0.5504    ProQ2: 0.4385       
Pseudo-energy (x10^4 J): GOAP: -1.3111    DFIRE: -0.9181
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 9
(model_5_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8202    MQAPmulti: 0.8893    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6050    MetaMQAP: 0.5588    ProQ2: 0.4372       
Pseudo-energy (x10^4 J): GOAP: -1.3505    DFIRE: -0.9253
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 10
(model_57_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7987    MQAPmulti: 0.8820    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6097    MetaMQAP: 0.5189    ProQ2: 0.4336       
Pseudo-energy (x10^4 J): GOAP: -1.3250    DFIRE: -0.9249
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 11
(model_93_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6118    MQAPmulti: 0.7750    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5790    MetaMQAP: 0.5315    ProQ2: 0.4334       
Pseudo-energy (x10^4 J): GOAP: -1.2043    DFIRE: -0.8836
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 12
(model_82_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6831    MQAPmulti: 0.7828    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5930    MetaMQAP: 0.5567    ProQ2: 0.4285       
Pseudo-energy (x10^4 J): GOAP: -1.2672    DFIRE: -0.9003
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 13
(model_98_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7610    MQAPmulti: 0.8714    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5969    MetaMQAP: 0.5294    ProQ2: 0.4269       
Pseudo-energy (x10^4 J): GOAP: -1.3243    DFIRE: -0.9012
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 14
(model_59_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8373    MQAPmulti: 0.8976    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6178    MetaMQAP: 0.5189    ProQ2: 0.4261       
Pseudo-energy (x10^4 J): GOAP: -1.3249    DFIRE: -0.9241
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 15
(QUARK_TS2)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.6365    MQAPmulti: 0.7768    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5877    MetaMQAP: 0.5924    ProQ2: 0.4261       
Pseudo-energy (x10^4 J): GOAP: -1.2394    DFIRE: -0.9088
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 16
(model_10_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7773    MQAPmulti: 0.8821    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5973    MetaMQAP: 0.4979    ProQ2: 0.4259       
Pseudo-energy (x10^4 J): GOAP: -1.3519    DFIRE: -0.9268
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 17
(model_41_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8025    MQAPmulti: 0.8875    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6077    MetaMQAP: 0.5483    ProQ2: 0.4255       
Pseudo-energy (x10^4 J): GOAP: -1.3286    DFIRE: -0.9298
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 18
(model_71_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8299    MQAPmulti: 0.8873    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6104    MetaMQAP: 0.5441    ProQ2: 0.4247       
Pseudo-energy (x10^4 J): GOAP: -1.3541    DFIRE: -0.9277
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 19
(model_2_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7973    MQAPmulti: 0.8868    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6094    MetaMQAP: 0.5693    ProQ2: 0.4241       
Pseudo-energy (x10^4 J): GOAP: -1.3299    DFIRE: -0.9362
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


BEST MODEL 20
(model_67_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8014    MQAPmulti: 0.8864    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6014    MetaMQAP: 0.4937    ProQ2: 0.4234       
Pseudo-energy (x10^4 J): GOAP: -1.3394    DFIRE: -0.9256
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MetaMQAP: 0Å 
 
 8Å

 


Valid HTML 4.01!