QA-RecombineIt results for job id CASP_T0523_140916UgX7oc

RecombineIt: recombination mode.

Summary

Here are the results of the RecombineIt mode. In this mode our server combines fragments with high predicted accuracy to build new hybrid models with accuracy improved compared to the starting models.
Usually, over 100 millions possible combinations of fragments are tested, then 100 final models are built by the MODELLER program.

The models presented here are ordered according to the MQAPcomb global score. Rank models by: MQAPmulti MQAPsingle MetaMQAP ProQ2 GOAP DFIRE .
The number of the best models presented here is 50. Display different number of models: 5 10 20 .
The local model quality along the sequence is based on the MQAPmulti local score. Choose another score of local model quality: MQAPcomb MetaMQAP ProQ2 MQAPsingle

Please note that this website has been tested and optimized for Mozilla, Firefox, Opera, and Chrome.

Tools

Sequence 1D information

Here, you can find PREDICTED secondary structure, solvent accessibility and protein order. The predictions were performed for the submitted target sequence.

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structue
Solvent Accessibility
Protein Order

Model quality assessment

This section presents the Quality Assessment of the hybrid models created by our recombination algorithm (RecombineIt) and the 5 highest scored models by MQAPmulti from those submitted by you.
These models are ordered according to the MQAPcomb global score. The top model is the one with the highest predicted global accuracy.
Also the local model accuracy, as the MQAPmulti score, is presented as a heat map. The colors correspond to the local error expressed in Angstrom.
Colors are in the range from BLUE: 0 Angstroms to RED: 8 Angstroms and more.

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
 
MODEL NAME
glob: MQAPcomb
 loc: MQAPmulti: 0Å 
 
 8Å
 
0.841    0.898
0.837    0.898
0.832    0.898
0.831    0.887
0.830    0.887
0.830    0.892
0.827    0.898
0.823    0.885
0.820    0.889
0.818    0.895
0.817    0.888
0.817    0.898
0.813    0.892
0.813    0.892
0.810    0.889
0.809    0.885
0.807    0.891
0.807    0.897
0.805    0.897
0.803    0.888
0.802    0.891
0.802    0.893
0.801    0.886
0.801    0.898
0.800    0.884
0.799    0.882
0.798    0.885
0.798    0.890
0.797    0.887
0.796    0.887
0.796    0.895
0.795    0.885
0.795    0.887
0.794    0.892
0.793    0.884
0.793    0.861
0.791    0.893
0.791    0.887
0.790    0.890
0.790    0.889
0.789    0.865
0.789    0.891
0.789    0.891
0.788    0.891
0.786    0.886
0.786    0.887
0.784    0.888
0.784    0.893
0.782    0.882
0.780    0.861

Model fragments

The RecombineIt algorithm has sampled several milions of possible combinations of the fragments derived from your input models.
For the 100 most promissing combinations, the MODELLER program created models of the target protein.
Here, we present these models composition. Every fragment is named according to the initial models it comes from.

Fragment cloud - the greater the font size, the more often the fragments derived from a given initial models were used to build the hybrid models presented here.
BAKER-ROSETTASERVER_TS2 BAKER-ROSETTASERVER_TS3 BAKER-ROSETTASERVER_TS4 IntFOLD-TS_TS1 QUARK_TS1 QUARK_TS2 QUARK_TS3 RaptorX-Boost_TS2 RaptorX-MSA_TS1 RaptorX_TS1 ZHOU-SPARKS-X_TS2 ZHOU-SPARKS-X_TS5 Zhang-Server_TS1 Zhang-Server_TS2 Zhang-Server_TS3 Zhang-Server_TS4 Zhang-Server_TS5 chunk-TASSER_TS1 chunk-TASSER_TS2 chunk-TASSER_TS3 chunk-TASSER_TS4 chunk-TASSER_TS5 
Sequence
Fragment definition
 
MODEL NAME
glob: MQAPcomb
 
Below, the fragments boundaries are presented
 
0.841    0.898
                                                                                                                        
0.837    0.898
                                                                                                                        
0.832    0.898
                                                                                                                        
0.831    0.887
                                                                                                                        
0.830    0.887
                                                                                                                        
0.830    0.892
                                                                                                                        
0.827    0.898
                                                                                                                        
0.823    0.885
                                                                                                                        
0.820    0.889
                                                                                                                        
0.818    0.895
                                                                                                                        
0.817    0.888
                                                                                                                        
0.817    0.898
                                                                                                                        
0.813    0.892
                                                                                                                        
0.813    0.892
                                                                                                                        
0.810    0.889
                                                                                                                        
0.809    0.885
                                                                                                                        
0.807    0.891
                                                                                                                        
0.807    0.897
                                                                                                                        
0.805    0.897
                                                                                                                        
0.803    0.888
                                                                                                                        
0.802    0.891
                                                                                                                        
0.802    0.893
                                                                                                                        
0.801    0.886
                                                                                                                        
0.801    0.898
                                                                                                                        
0.800    0.884
                                                                                                                        
0.799    0.882
                                                                                                                        
0.798    0.885
                                                                                                                        
0.798    0.890
                                                                                                                        
0.797    0.887
                                                                                                                        
0.796    0.887
                                                                                                                        
0.796    0.895
                                                                                                                        
0.795    0.885
                                                                                                                        
0.795    0.887
                                                                                                                        
0.794    0.892
                                                                                                                        
0.793    0.884
                                                                                                                        
0.793    0.861
                                                                                                                        
0.791    0.893
                                                                                                                        
0.791    0.887
                                                                                                                        
0.790    0.890
                                                                                                                        
0.790    0.889
                                                                                                                        
0.789    0.865
                                                                                                                        
0.789    0.891
                                                                                                                        
0.789    0.891
                                                                                                                        
0.788    0.891
                                                                                                                        
0.786    0.886
                                                                                                                        
0.786    0.887
                                                                                                                        
0.784    0.888
                                                                                                                        
0.784    0.893
                                                                                                                        
0.782    0.882
                                                                                                                        
0.780    0.861
                                                                                                                        

Detailed information

BEST MODEL 1
(model_80_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8413    MQAPmulti: 0.8977    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6051    MetaMQAP: 0.5399    ProQ2: 0.4576       
Pseudo-energy (x10^4 J): GOAP: -1.3288    DFIRE: -0.9280
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 2
(model_59_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8373    MQAPmulti: 0.8976    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6178    MetaMQAP: 0.5189    ProQ2: 0.4261       
Pseudo-energy (x10^4 J): GOAP: -1.3249    DFIRE: -0.9241
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 3
(model_22_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8325    MQAPmulti: 0.8977    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6106    MetaMQAP: 0.5084    ProQ2: 0.3818       
Pseudo-energy (x10^4 J): GOAP: -1.2891    DFIRE: -0.9249
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 4
(model_92_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8311    MQAPmulti: 0.8870    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6070    MetaMQAP: 0.5294    ProQ2: 0.4449       
Pseudo-energy (x10^4 J): GOAP: -1.2933    DFIRE: -0.9262
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 5
(model_71_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8299    MQAPmulti: 0.8873    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6104    MetaMQAP: 0.5441    ProQ2: 0.4247       
Pseudo-energy (x10^4 J): GOAP: -1.3541    DFIRE: -0.9277
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 6
(model_12_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8296    MQAPmulti: 0.8916    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6211    MetaMQAP: 0.5462    ProQ2: 0.3867       
Pseudo-energy (x10^4 J): GOAP: -1.2883    DFIRE: -0.9062
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 7
(model_8_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8269    MQAPmulti: 0.8976    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6238    MetaMQAP: 0.5630    ProQ2: 0.3859       
Pseudo-energy (x10^4 J): GOAP: -1.2960    DFIRE: -0.9151
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 8
(model_35_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8234    MQAPmulti: 0.8846    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6142    MetaMQAP: 0.5483    ProQ2: 0.4644       
Pseudo-energy (x10^4 J): GOAP: -1.3423    DFIRE: -0.9341
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 9
(model_5_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8202    MQAPmulti: 0.8893    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6050    MetaMQAP: 0.5588    ProQ2: 0.4372       
Pseudo-energy (x10^4 J): GOAP: -1.3505    DFIRE: -0.9253
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 10
(model_24_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8179    MQAPmulti: 0.8951    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6227    MetaMQAP: 0.5609    ProQ2: 0.4020       
Pseudo-energy (x10^4 J): GOAP: -1.2739    DFIRE: -0.9119
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 11
(model_33_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8168    MQAPmulti: 0.8876    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6113    MetaMQAP: 0.5693    ProQ2: 0.4428       
Pseudo-energy (x10^4 J): GOAP: -1.3218    DFIRE: -0.9206
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 12
(model_44_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8167    MQAPmulti: 0.8976    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6033    MetaMQAP: 0.6534    ProQ2: 0.4730       
Pseudo-energy (x10^4 J): GOAP: -1.3327    DFIRE: -0.9271
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 13
(model_16_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8133    MQAPmulti: 0.8923    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6094    MetaMQAP: 0.5399    ProQ2: 0.3804       
Pseudo-energy (x10^4 J): GOAP: -1.3063    DFIRE: -0.9108
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 14
(model_6_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8129    MQAPmulti: 0.8921    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6151    MetaMQAP: 0.5399    ProQ2: 0.3667       
Pseudo-energy (x10^4 J): GOAP: -1.2909    DFIRE: -0.9117
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 15
(QUARK_TS1)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8100    MQAPmulti: 0.8891    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6086    MetaMQAP: 0.5147    ProQ2: 0.4421       
Pseudo-energy (x10^4 J): GOAP: -1.3135    DFIRE: -0.9186
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 16
(model_29_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8086    MQAPmulti: 0.8848    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6186    MetaMQAP: 0.5567    ProQ2: 0.4009       
Pseudo-energy (x10^4 J): GOAP: -1.2909    DFIRE: -0.9143
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 17
(model_23_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8074    MQAPmulti: 0.8907    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6131    MetaMQAP: 0.5420    ProQ2: 0.3710       
Pseudo-energy (x10^4 J): GOAP: -1.2811    DFIRE: -0.9114
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 18
(model_13_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8066    MQAPmulti: 0.8975    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6175    MetaMQAP: 0.5420    ProQ2: 0.3811       
Pseudo-energy (x10^4 J): GOAP: -1.2887    DFIRE: -0.9123
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 19
(model_15_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8046    MQAPmulti: 0.8971    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6109    MetaMQAP: 0.5336    ProQ2: 0.3735       
Pseudo-energy (x10^4 J): GOAP: -1.3006    DFIRE: -0.9098
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 20
(model_41_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8025    MQAPmulti: 0.8875    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6077    MetaMQAP: 0.5483    ProQ2: 0.4255       
Pseudo-energy (x10^4 J): GOAP: -1.3286    DFIRE: -0.9298
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 21
(model_26_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8018    MQAPmulti: 0.8910    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6125    MetaMQAP: 0.5189    ProQ2: 0.3997       
Pseudo-energy (x10^4 J): GOAP: -1.2717    DFIRE: -0.9108
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 22
(model_46_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8017    MQAPmulti: 0.8927    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6063    MetaMQAP: 0.5189    ProQ2: 0.3959       
Pseudo-energy (x10^4 J): GOAP: -1.3010    DFIRE: -0.9217
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 23
(model_67_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8014    MQAPmulti: 0.8864    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6014    MetaMQAP: 0.4937    ProQ2: 0.4234       
Pseudo-energy (x10^4 J): GOAP: -1.3394    DFIRE: -0.9256
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 24
(model_81_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8012    MQAPmulti: 0.8976    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6074    MetaMQAP: 0.5273    ProQ2: 0.3749       
Pseudo-energy (x10^4 J): GOAP: -1.2927    DFIRE: -0.9245
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 25
(model_52_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.8001    MQAPmulti: 0.8841    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6122    MetaMQAP: 0.5399    ProQ2: 0.4016       
Pseudo-energy (x10^4 J): GOAP: -1.2106    DFIRE: -0.9030
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 26
(model_57_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7987    MQAPmulti: 0.8820    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6097    MetaMQAP: 0.5189    ProQ2: 0.4336       
Pseudo-energy (x10^4 J): GOAP: -1.3250    DFIRE: -0.9249
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 27
(model_27_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7982    MQAPmulti: 0.8847    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6049    MetaMQAP: 0.5021    ProQ2: 0.4033       
Pseudo-energy (x10^4 J): GOAP: -1.2808    DFIRE: -0.9238
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 28
(model_79_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7979    MQAPmulti: 0.8899    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6168    MetaMQAP: 0.5693    ProQ2: 0.3986       
Pseudo-energy (x10^4 J): GOAP: -1.2655    DFIRE: -0.9207
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 29
(model_2_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7973    MQAPmulti: 0.8868    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6094    MetaMQAP: 0.5693    ProQ2: 0.4241       
Pseudo-energy (x10^4 J): GOAP: -1.3299    DFIRE: -0.9362
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 30
(model_55_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7964    MQAPmulti: 0.8866    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6072    MetaMQAP: 0.5504    ProQ2: 0.4385       
Pseudo-energy (x10^4 J): GOAP: -1.3111    DFIRE: -0.9181
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 31
(model_25_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7955    MQAPmulti: 0.8946    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6133    MetaMQAP: 0.5609    ProQ2: 0.3923       
Pseudo-energy (x10^4 J): GOAP: -1.2694    DFIRE: -0.9097
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 32
(model_42_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7954    MQAPmulti: 0.8853    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6135    MetaMQAP: 0.5189    ProQ2: 0.3855       
Pseudo-energy (x10^4 J): GOAP: -1.2819    DFIRE: -0.9005
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 33
(model_94_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7953    MQAPmulti: 0.8867    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6019    MetaMQAP: 0.5252    ProQ2: 0.3697       
Pseudo-energy (x10^4 J): GOAP: -1.2015    DFIRE: -0.9161
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 34
(model_28_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7940    MQAPmulti: 0.8917    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6108    MetaMQAP: 0.5546    ProQ2: 0.3747       
Pseudo-energy (x10^4 J): GOAP: -1.2704    DFIRE: -0.9067
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 35
(model_95_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7931    MQAPmulti: 0.8842    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6065    MetaMQAP: 0.5399    ProQ2: 0.3786       
Pseudo-energy (x10^4 J): GOAP: -1.2786    DFIRE: -0.9044
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 36
(model_14_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7931    MQAPmulti: 0.8610    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6011    MetaMQAP: 0.5378    ProQ2: 0.4203       
Pseudo-energy (x10^4 J): GOAP: -1.2487    DFIRE: -0.9112
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 37
(model_21_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7908    MQAPmulti: 0.8929    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6119    MetaMQAP: 0.5588    ProQ2: 0.3733       
Pseudo-energy (x10^4 J): GOAP: -1.3091    DFIRE: -0.9248
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 38
(model_89_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7907    MQAPmulti: 0.8873    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6167    MetaMQAP: 0.5357    ProQ2: 0.4059       
Pseudo-energy (x10^4 J): GOAP: -1.2728    DFIRE: -0.9117
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 39
(model_18_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7904    MQAPmulti: 0.8903    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6134    MetaMQAP: 0.5084    ProQ2: 0.3635       
Pseudo-energy (x10^4 J): GOAP: -1.2872    DFIRE: -0.9075
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 40
(model_45_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7898    MQAPmulti: 0.8888    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6016    MetaMQAP: 0.5294    ProQ2: 0.4101       
Pseudo-energy (x10^4 J): GOAP: -1.3384    DFIRE: -0.9231
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 41
(model_70_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7893    MQAPmulti: 0.8648    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6087    MetaMQAP: 0.4580    ProQ2: 0.3891       
Pseudo-energy (x10^4 J): GOAP: -1.2097    DFIRE: -0.8895
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 42
(model_9_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7891    MQAPmulti: 0.8908    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6097    MetaMQAP: 0.4916    ProQ2: 0.3725       
Pseudo-energy (x10^4 J): GOAP: -1.2830    DFIRE: -0.9085
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 43
(model_64_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7889    MQAPmulti: 0.8909    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6157    MetaMQAP: 0.5168    ProQ2: 0.3853       
Pseudo-energy (x10^4 J): GOAP: -1.2058    DFIRE: -0.9077
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 44
(model_1_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7883    MQAPmulti: 0.8905    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6081    MetaMQAP: 0.4706    ProQ2: 0.3883       
Pseudo-energy (x10^4 J): GOAP: -1.2758    DFIRE: -0.9128
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 45
(model_99_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7862    MQAPmulti: 0.8857    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6092    MetaMQAP: 0.5315    ProQ2: 0.3817       
Pseudo-energy (x10^4 J): GOAP: -1.2675    DFIRE: -0.9100
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 46
(model_36_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7857    MQAPmulti: 0.8870    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6025    MetaMQAP: 0.5357    ProQ2: 0.4062       
Pseudo-energy (x10^4 J): GOAP: -1.3390    DFIRE: -0.9316
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 47
(model_19_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7843    MQAPmulti: 0.8876    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6126    MetaMQAP: 0.4979    ProQ2: 0.3896       
Pseudo-energy (x10^4 J): GOAP: -1.2746    DFIRE: -0.9144
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 48
(model_7_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7839    MQAPmulti: 0.8931    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6182    MetaMQAP: 0.5315    ProQ2: 0.3727       
Pseudo-energy (x10^4 J): GOAP: -1.3009    DFIRE: -0.9100
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 49
(model_11_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7818    MQAPmulti: 0.8817    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.6113    MetaMQAP: 0.5378    ProQ2: 0.3890       
Pseudo-energy (x10^4 J): GOAP: -1.2864    DFIRE: -0.9005
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


BEST MODEL 50
(model_68_.pdb)
Clustering MQAPs (GDT_TS) :  MQAPcomb: 0.7803    MQAPmulti: 0.8607    
Single model MQAPs (GDT_TS):  MQAPsingle: 0.5995    MetaMQAP: 0.6008    ProQ2: 0.3933       
Pseudo-energy (x10^4 J): GOAP: -1.2621    DFIRE: -0.9065
download model

Sequence
PAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSATRRVA
Fragment definition
Secondary Structure
predicted
observed

Solvent Accessibility
predicted
observed

Protein Order
MQAPmulti: 0Å 
 
 8Å

 


Valid HTML 4.01!