Full name: tRNA threonylcarbamoyladenosine biosynthesis protein SUA5
Synonym:
GI: 417826
Orf: G1660
COG: COG0009
UniProt: P32579
Structures: | |
Complex: EKC/KEOPS
Enzyme type: threonylcarbamoyladenosine synthetase
Position of modification - modification: t:37 - t6A

Comments:

Sua5 homologues are found in genomes of organisms from all three domains of life. This protein binds threonine, ATP and U36A37-containing tRNA. Together with several other proteins of the so-called EKC/KEOPS complex, ATP, threonine and bicarbonate as cofactors, they catalyze the in vivo formation of t6A (threonyl-carbamoylation) at position 37 of all eukaryotic tRNAs decoding ANN codons (Ile, Met, Thr, Lys, Asn, Arg and Ser). However the detailed stepwise mechanism of t6A formation is still not known (March 2012).

Protein sequence:

MYLGRHFLAMTSKALFDTKILKVNPLSIIFSPDAHIDGSLPTITDPETEAALVEAARIIRDTDETVAFPT ETVYGLGGSALNDNSVLSIYRAKNRPSDNPLITHVSSIDQLNRKVFNQPHLSGTSLFDNIPSIYRPLISS LWPGPLTILLPVPSSEHSALSKLTTADQPTFAVRIPANPVARALIALSDTPIAAPSANASTRPSPTLASH VYHDLKDKIPIILDGGACKVGVESTVVDGLCNPPTLLRPGGFTYEEIVKLGGEAWSLCKVENKKTVEKGE KVRTPGMKYRHYSPSAKVVLLVPHCEGDGILKGVDRMERLKRLIETELKANSNIKKIAILTSLKLRDSDL QSKIFNEPDFSSKTFIIERLGQSGEEIQTNLFAALRKVDENDKVDLIFVEGINEEGEGLAVMNRLRKAAA NNCIQF

Enzymatic activities:

Reaction Substrate Type Position
A:t6A tRNA (t)   37

Publications:

Title Authors Journal Details PubMed Id DOI
Isolation and characterization of SUA5, a novel gene required for normal growth in Saccharomyces cerevisiae. Na JG, Pinto I, Hampsey M Genetics [details] 1325384 -
The universal YrdC/Sua5 family is required for the formation of threonylcarbamoyladenosine in tRNA. El Yacoubi B, Lyons B, Cruz Y, Reddy R, Nordin B, Agnelli F, Williamson JR, Schimmel P, Swairjo MA, de Crecy-Lagard V Nucleic Acids Res [details] 19287007 -
The Sua5 protein is essential for normal translational regulation in yeast. Lin CA, Ellis SR, True HL Mol Cell Biol [details] 19884342 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto