Full name: Iron-binding protein iscA
Synonym: YfhF
GI: 16130453
Orf: b2528
COG: COG0316
UniProt: P0AAC8
Structures: | 1S98 |
Complex:

Comments:

IscA is a scaffold protein for the [Fe-S] clusters. It binds ferredoxin, iron and [2Fe-2S] clusters, and participates in the biosynthesis of iron-sulfur proteins, including (dimethylallyl)adenosine tRNA methylthiotransferase MiaB. IscA homolog in human is IscA1, however its function is not clear.

Protein sequence:

MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEDKGVKVVVDGKSLQ FLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV

Publications:

Title Authors Journal Details PubMed Id DOI
Iron-sulfur cluster assembly: characterization of IscA and evidence for a specific and functional complex with ferredoxin. Ollagnier-de-Choudens S, Mattioli T, Takahashi Y, Fontecave M J Biol Chem [details] 11319236 -
Formation of thiolated nucleosides present in tRNA from Salmonella enterica serovar Typhimurium occurs in two principally distinct pathways. Leipuviene R, Qian Q, Bjork GR J Bacteriol [details] 14729702 -
SufA/IscA: reactivity studies of a class of scaffold proteins involved in [Fe-S] cluster assembly. Ollagnier-de-Choudens S, Sanakis Y, Fontecave M... J Biol Inorg Chem [details] 15278785 -

Links:

_PubMed_
_Wikipedia_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto