Full name: tRNA wybutosine-synthesizing protein 2
Synonym: Trm12, YMA5
GI: 2497109
Orf: YML005W
COG: COG2520
UniProt: Q04235
Structures: | |
Complex:
Enzyme type: Alpha-amino-alpha-carboxypropyltransferase
Position of modification - modification: t:37 - yW

Comments:

TYW2 transfers α-amino-α-carboxypropyl group from Ado-Met to the side chain at the C-7 position of the yW-187 (imG-14) to produce yW-86.

Protein sequence:

MSDETMPVEFLVSDKRLLKTIKVKLETNGLFVTPIYSDNDNKVIKSSIEDLNHPLAVEINNIAGVKARFH ESGNLERSEGHLKHQSNSITEFTKSFLKDHGLANDKIFLSHLLDHLPLKYTIYPPVVLFNNSTVRSFNHP IWQKAFQLKLFDPNEYYRELLCFLSPGKPSKGTSLHPNNRLLTHLAINNPITEADVLRRPFNIQPLYGKL IDDSILDDNDNTLWENPSQEQLNSSIWCKVIQNGVTQIWSPVFTMFSRGNIKEKKRVLTTFPDICNNDVV DLYAGIGYFTFSYLTKGARTLFAFELNPWSVEGLKRGLKANGFNKSGNCHVFQESNEMCVQRLTEFLSQN PGFRLRIRHINLGLLPSSKQGWPLAIKLIYLQGASLEKVTMHIHENVHIDAIEDGSFEKNVIVELDAINE SIALIRNRGIKLQFVRSKLERIKTFAPDIWHVCVDVDVIVST

Enzymatic activities:

Reaction Substrate Type Position
imG-14:yW-86 tRNA (t)   37

Publications:

Title Authors Journal Details PubMed Id DOI
Biosynthesis of wybutosine, a hyper-modified nucleoside in eukaryotic phenylalanine tRNA. Noma A, Kirino Y, Ikeuchi Y, Suzuki T EMBO J [details] 16642040 -
A novel methyltransferase required for the formation of the hypermodified nucleoside wybutosine in eucaryotic tRNA. Kalhor HR, Penjwini M, Clarke S Biochem Biophys Res Commun [details] 16005430 -

Links:

_SGD_
_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto