Modomics - A Database of RNA Modifications

Full name:	H/ACA ribonucleoprotein complex subunit 4
Synonym:	dyskerine
GI:	461698
Orf:	YLR175W
COG:	COG0130
UniProt:	P33322
Structures:	\| 3UAI \| 3U28 \|
Complex:	H/ACA RNP
Enzyme type:	pseudouridine synthase
Position of modification - modification:	t:many - Y s:many - Y l:many - Y n:many - Y

Comments:

Eukaryal Cbf5 is the catalytic subunit of H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNPs) complex. Catalyzes the pseudouridylation of rRNA (including 5S and 5.8S rRNA) and small RNAs (snRNAs, snoRNAs). Contains one PUA domain. Works with 3 other subunits Gar1p, Nop10p, Nhp2p. A fifth protein (Shq1) is required for H/ACA RNP biogenenesis. In Eukarya, H/ACA RNPs are essential for three fundamental cellular processes: protein synthesis, mRNA splicing, and maintenance of genome integrity. For detailed information on modified positions see the snoRNA table ( http://modomics.genesilico.pl/snorna/ ).

Protein sequence:

MSKEDFVIKPEAAGASTDTSEWPLLLKNFDKLLVRSGHYTPIPAGSSPLKRDLKSYISSGVINLDKPSNPSSHEVVAWIKRILRCEKTGHSGTLDPKVTG
CLIVCIDRATRLVKSQQGAGKEYVCIVRLHDALKDEKDLGRSLENLTGALFQRPPLISAVKRQLRVRTIYESNLIEFDNKRNLGVFWASCEAGTYMRTLC
VHLGMLLGVGGHMQELRRVRSGALSENDNMVTLHDVMDAQWVYDNTRDESYLRSIIQPLETLLVGYKRIVVKDSAVNAVCYGAKLMIPGLLRYEEGIELY
DEIVLITTKGEAIAVAIAQMSTVDLASCDHGVVASVKRCIMERDLYPRRWGLGPVAQKKKQMKADGKLDKYGRVNENTPEQWKKEYVPLDNAEQSTSSSQ
ETKETEEEPKKAKEDSLIKEVETEKEEVKEDDSKKEKKEKKDKKEKKEKKEKKDKKEKKEKKEKKRKSEDGDSEEKKSKKSKK

Enzymatic activities:

Reaction	Substrate	Type	Position
U:Y	rRNA (r)	SSU/18S/eukaryotic cytosol	many
U:Y	rRNA (r)	LSU-L/25S/eukaryotic cytosol	many
U:Y	pre-rRNA (pre-r)	all/35S/prokaryotic cytosol	many
U:Y	snRNA (sn)	all/all/eukaryotic cytosol	many

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
An essential yeast protein, CBF5p, binds in vitro to centromeres and microtubules.	Jiang W, Middleton K, Yoon HJ, Fouquet C, Carbon J	Mol Cell Biol	[details]	8336724	-
The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs.	Hamma T, Reichow SL, Varani G, Ferre-D'Amare AR	Nat Struct Mol Biol	[details]	16286935	-
Crystal structure of a Cbf5-Nop10-Gar1 complex and implications in RNA-guided pseudouridylation and dyskeratosis congenita.	Rashid R, Liang B, Baker DL, Youssef OA, He Y, Phipps K, Terns RM, Terns MP, Li H	Mol Cell	[details]	16427014	-
The box H + ACA snoRNAs carry Cbf5p, the putative rRNA pseudouridine synthase.	Lafontaine DL, Bousquet-Antonelli C, Henry Y, Caizergues-Ferrer M, Tollervey D	Genes Dev	[details]	9472021	-
Point mutations in yeast CBF5 can abolish in vivo pseudouridylation of rRNA.	Zebarjadian Y, King T, Fournier MJ, Clarke L, Carbon J	Mol Cell Biol	[details]	10523634	-
Structure of the Shq1-Cbf5-Nop10-Gar1 complex and implications for H/ACA RNP biogenesis and dyskeratosis congenita.	Li S, Duan J, Li D, Ma S, Ye K	EMBO J	[details]	22117216	-
Cbf5p, the putative pseudouridine synthase of H/ACA-type snoRNPs, can form a complex with Gar1p and Nop10p in absence of Nhp2p and box H/ACA snoRNAs.	Henras AK, Capeyrou R, Henry Y, Caizergues-Ferrer M	RNA	[details]	15388873	-
The box H/ACA RNP assembly factor Naf1p contains a domain homologous to Gar1p mediating its interaction with Cbf5p.	Leulliot N, Godin KS, Hoareau-Aveilla C, Quevillon-Cheruel S, Varani G, Henry Y, Van Tilbeurgh H...	J Mol Biol	[details]	17612558	-

Links:

_SGD_
_The yeast snoRNA database_
_Wikipedia - Small nucleolar RNA_
_Wikipedia - Pseudouridylate synthase_
_PubMed_

_SGD_

_The yeast snoRNA database_

_Wikipedia - Small nucleolar RNA_

_Wikipedia - Pseudouridylate synthase_

_PubMed_