Modomics - A Database of RNA Modifications

Full name: tRNA uridine(34) 5-carboxymethylaminomethyl synthesis GTPase
Synonym: ThdF, TrmE
GI: 2851487
Orf: b3706
COG: COG0486
UniProt: P25522
Structures: | 2GJ8 | 2GJ9 | 2GJA |
Complex: MnmE/MnmG
Enzyme type: GTPase
Position of modification - modification: t:34 - cmnm5s2U
t:34 - mnm5s2U
t:34 - cmnm5Um
t:34 - mnm5U

Comments:

Hydrolyses GTP (contains a P-loop domain). MnmE works as a dimer in complex with MnmG (GidA, also a dimer). MnmEG complex catalyzes two different reactions dependent on the substrate (glycine or ammonium). The choice between glycine and ammonium was shown to be influenced by growth phase and medium with glycine pathway being chosen in minimal medium and in exponential phase. However, in the case of tRNAGlncmnm5s2U the glycine pathway is always the dominant one and for tRNALeucmnm5Um the ammonium pathway was observed only in vitro. MnmE has been shown to negatively regulate the activity on MiaB involved in methylthiolation of i6A37 of tRNA. Crystal structures available only for the G-domain. The homologue from P. aeruginosa has been crystallized. The yeast mitochondrial homolog is Mss1, working in complex with Mto1.

Protein sequence:

MSDNDTIVAQATPPGRGGVGILRISGFKAREVAETVLGKLPKPRYADYLPFKDADGSVLDQGIALWFPGPNSFTGEDVLELQGHGGPVILDLLLKRILTI
PGLRIARPGEFSERAFLNDKLDLAQAEAIADLIDASSEQAARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFPDEEIDFLSDGKIEAQLNDVIADL
DAVRAEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLREHIHIDGMPLHIIDTAGLREASDEVERIGIERAWQEIEQADRVL
FMVDGTTTDAVDPAEIWPEFIARLPAKLPITVVRNKADITGETLGMSEVNGHALIRLSARTGEGVDVLRNHLKQSMGFDTNMEGGFLARRRHLQALEQAA
EHLQQGKAQLLGAWAGELLAEELRLAQQNLSEITGEFTSDDLLGRIFSSFCIGK

Enzymatic activities:

Reaction Substrate Type Position
U:cmnm5U tRNA (t) Lys/SUU/prokaryotic cytosol 34
U:nm5U tRNA (t) Lys/SUU/prokaryotic cytosol 34
Um:cmnm5Um tRNA (t) Leu/)AA/prokaryotic cytosol 34
s2U:nm5s2U tRNA (t) Lys/SUU/prokaryotic cytosol 34
se2U:nm5se2U tRNA (t)   34
s2U:cmnm5s2U tRNA (t) Lys/SUU/prokaryotic cytosol 34
se2U:cmnm5se2U tRNA (t)   34
s2U:cmnm5s2U tRNA (t) Glu/SUC/prokaryotic cytosol 34
s2U:cmnm5s2U tRNA (t) Gln/$UG/prokaryotic cytosol 34
U:cmnm5U tRNA (t) Glu/SUC/prokaryotic cytosol 34
s2U:nm5s2U tRNA (t) Glu/SUC/prokaryotic cytosol 34
U:nm5U tRNA (t) Glu/SUC/prokaryotic cytosol 34
U:cmnm5U tRNA (t) Gln/$UG/prokaryotic cytosol 34
s2U:nm5s2U tRNA (t) Gln/$UG/prokaryotic cytosol 34
U:nm5U tRNA (t) Gln/$UG/prokaryotic cytosol 34
U:nm5U tRNA (t) Leu/)AA/prokaryotic cytosol 34
U:cmnm5U tRNA (t) Leu/)AA/prokaryotic cytosol 34
U:nm5U tRNA (t) Arg/{CU/prokaryotic cytosol 34
U:cmnm5U tRNA (t) Arg/{CU/prokaryotic cytosol 34
U:nm5U tRNA (t) Gly/{CC/prokaryotic cytosol 34
U:cmnm5U tRNA (t) Gly/{CC/prokaryotic cytosol 34

Publications:

Title Authors Journal Details PubMed Id DOI
The Escherichia coli trmE (mnmE) gene, involved in tRNA modification, codes for an evolutionarily conserved GTPase with unusual biochemical properties. Cabedo H, Macian F, Villarroya M, Escudero JC, Martinez-Vicente M, Knecht E, Armengod ME EMBO J [details] 10601028 -
The structure of the TrmE GTP-binding protein and its implications for tRNA modification. Scrima A, Vetter IR, Armengod ME, Wittinghofer A EMBO J [details] 15616586 -
Dimerisation-dependent GTPase reaction of MnmE: how potassium acts as GTPase-activating element. Scrima A, Wittinghofer A EMBO J [details] 16763562 -
Evolutionarily conserved proteins MnmE and GidA catalyze the formation of two methyluridine derivatives at tRNA wobble positions. Moukadiri I, Prado S, Piera J, Velázquez-Campoy A, Björk GR, Armengod ME Nucleic Acids Res [details] 19767610 -
Overexpression, crystallization and preliminary X-ray crystallographic analysis of Pseudomonas aeruginosa MnmE, a GTPase involved in tRNA modification. Lee HH, Suh SW Acta Crystallogr Sect F Struct Biol Cryst Commun [details] 20693664 -
Enzymology of tRNA modification in the bacterial MnmEG pathway. Armengod ME, Moukadiri I, Prado S, Ruiz-Partida R, Benitez-Paez A, Villarroya M, Lomas R, Garzon MJ, Martinez-Zamora A, Meseguer S, Navarro-Gonzalez C Biochimie [details] 22386868 -
The output of the tRNA modification pathways controlled by the Escherichia coli MnmEG and MnmC enzymes depends on the growth conditions and the tRNA species. Moukadiri I, Garzon MJ, Bjork GR, Armengod ME... Nucleic Acids Res [details] 24293650 -
SAXS analysis of the tRNA-modifying enzyme complex MnmE/MnmG reveals a novel interaction mode and GTP-induced oligomerization. Fislage M, Brosens E, Deyaert E, Spilotros A, Pardon E, Loris R, Steyaert J, Garcia-Pino A, Versees W... Nucleic Acids Res [details] 24634441 -

Links:

_EcoCyc_
_PubMed_

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca