Full name: | tRNA uridine(34) 5-carboxymethylaminomethyl synthesis GTPase |
---|---|
Synonym: | ThdF, TrmE |
GI: | 2851487 |
Orf: | b3706 |
COG: | COG0486 |
UniProt: | P25522 |
Structures: | | 2GJ8 | 2GJ9 | 2GJA | |
Complex: | MnmE/MnmG |
Enzyme type: | GTPase |
Position of modification - modification: |
t:34 - cmnm5s2U t:34 - mnm5s2U t:34 - cmnm5Um t:34 - mnm5U |
MSDNDTIVAQATPPGRGGVGILRISGFKAREVAETVLGKLPKPRYADYLPFKDADGSVLDQGIALWFPGPNSFTGEDVLELQGHGGPVILDLLLKRILTI PGLRIARPGEFSERAFLNDKLDLAQAEAIADLIDASSEQAARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFPDEEIDFLSDGKIEAQLNDVIADL DAVRAEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLREHIHIDGMPLHIIDTAGLREASDEVERIGIERAWQEIEQADRVL FMVDGTTTDAVDPAEIWPEFIARLPAKLPITVVRNKADITGETLGMSEVNGHALIRLSARTGEGVDVLRNHLKQSMGFDTNMEGGFLARRRHLQALEQAA EHLQQGKAQLLGAWAGELLAEELRLAQQNLSEITGEFTSDDLLGRIFSSFCIGK
Reaction | Substrate | Type | Position |
---|---|---|---|
U:cmnm5U | tRNA (t) | Lys/SUU/prokaryotic cytosol | 34 |
U:nm5U | tRNA (t) | Lys/SUU/prokaryotic cytosol | 34 |
Um:cmnm5Um | tRNA (t) | Leu/)AA/prokaryotic cytosol | 34 |
s2U:nm5s2U | tRNA (t) | Lys/SUU/prokaryotic cytosol | 34 |
se2U:nm5se2U | tRNA (t) | 34 | |
s2U:cmnm5s2U | tRNA (t) | Lys/SUU/prokaryotic cytosol | 34 |
se2U:cmnm5se2U | tRNA (t) | 34 | |
s2U:cmnm5s2U | tRNA (t) | Glu/SUC/prokaryotic cytosol | 34 |
s2U:cmnm5s2U | tRNA (t) | Gln/$UG/prokaryotic cytosol | 34 |
U:cmnm5U | tRNA (t) | Glu/SUC/prokaryotic cytosol | 34 |
s2U:nm5s2U | tRNA (t) | Glu/SUC/prokaryotic cytosol | 34 |
U:nm5U | tRNA (t) | Glu/SUC/prokaryotic cytosol | 34 |
U:cmnm5U | tRNA (t) | Gln/$UG/prokaryotic cytosol | 34 |
s2U:nm5s2U | tRNA (t) | Gln/$UG/prokaryotic cytosol | 34 |
U:nm5U | tRNA (t) | Gln/$UG/prokaryotic cytosol | 34 |
U:nm5U | tRNA (t) | Leu/)AA/prokaryotic cytosol | 34 |
U:cmnm5U | tRNA (t) | Leu/)AA/prokaryotic cytosol | 34 |
U:nm5U | tRNA (t) | Arg/{CU/prokaryotic cytosol | 34 |
U:cmnm5U | tRNA (t) | Arg/{CU/prokaryotic cytosol | 34 |
U:nm5U | tRNA (t) | Gly/{CC/prokaryotic cytosol | 34 |
U:cmnm5U | tRNA (t) | Gly/{CC/prokaryotic cytosol | 34 |
Title | Authors | Journal | Details | ||
---|---|---|---|---|---|
The Escherichia coli trmE (mnmE) gene, involved in tRNA modification, codes for an evolutionarily conserved GTPase with unusual biochemical properties. | Cabedo H, Macian F, Villarroya M, Escudero JC, Martinez-Vicente M, Knecht E, Armengod ME | EMBO J | [details] | 10601028 | - |
The structure of the TrmE GTP-binding protein and its implications for tRNA modification. | Scrima A, Vetter IR, Armengod ME, Wittinghofer A | EMBO J | [details] | 15616586 | - |
Dimerisation-dependent GTPase reaction of MnmE: how potassium acts as GTPase-activating element. | Scrima A, Wittinghofer A | EMBO J | [details] | 16763562 | - |
Evolutionarily conserved proteins MnmE and GidA catalyze the formation of two methyluridine derivatives at tRNA wobble positions. | Moukadiri I, Prado S, Piera J, Velázquez-Campoy A, Björk GR, Armengod ME | Nucleic Acids Res | [details] | 19767610 | - |
Overexpression, crystallization and preliminary X-ray crystallographic analysis of Pseudomonas aeruginosa MnmE, a GTPase involved in tRNA modification. | Lee HH, Suh SW | Acta Crystallogr Sect F Struct Biol Cryst Commun | [details] | 20693664 | - |
Enzymology of tRNA modification in the bacterial MnmEG pathway. | Armengod ME, Moukadiri I, Prado S, Ruiz-Partida R, Benitez-Paez A, Villarroya M, Lomas R, Garzon MJ, Martinez-Zamora A, Meseguer S, Navarro-Gonzalez C | Biochimie | [details] | 22386868 | - |
The output of the tRNA modification pathways controlled by the Escherichia coli MnmEG and MnmC enzymes depends on the growth conditions and the tRNA species. | Moukadiri I, Garzon MJ, Bjork GR, Armengod ME... | Nucleic Acids Res | [details] | 24293650 | - |
SAXS analysis of the tRNA-modifying enzyme complex MnmE/MnmG reveals a novel interaction mode and GTP-induced oligomerization. | Fislage M, Brosens E, Deyaert E, Spilotros A, Pardon E, Loris R, Steyaert J, Garcia-Pino A, Versees W... | Nucleic Acids Res | [details] | 24634441 | - |
_EcoCyc_ |
_PubMed_ |