Full name: H/ACA ribonucleoprotein complex subunit 3
Synonym:
GI: 54036193
Orf: YHR072W-A
COG: COG2260
UniProt: Q6Q547
Structures: | 1Y2Y | 3UAI | 3U28 |
Complex: H/ACA RNP

Comments:

One of the essential subunits of H/ACA RNP complex catalysing pseudouridine formation in various RNAs and also mediating telomerase maintenance.

Protein sequence:

MHLMYTLGPDGKRIYTLKKVTESGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ

Publications:

Title Authors Journal Details PubMed Id DOI
Nhp2p and Nop10p are essential for the function of H/ACA snoRNPs. Henras A, Henry Y, Bousquet-Antonelli C, Noaillac-Depeyre J, Gelugne JP, Caizergues-Ferrer M EMBO J [details] 9843512 -
Reconstitution and structural analysis of the yeast box H/ACA RNA-guided pseudouridine synthase. Li S, Duan J, Li D, Yang B, Dong M, Ye K Genes Dev [details] 22085967 -
Structure of the Shq1-Cbf5-Nop10-Gar1 complex and implications for H/ACA RNP biogenesis and dyskeratosis congenita. Li S, Duan J, Li D, Ma S, Ye K EMBO J [details] 22117216 -
Structural study of the H/ACA snoRNP components Nop10p and the 3' hairpin of U65 snoRNA. Khanna M, Wu H, Johansson C, Caizergues-Ferrer M, Feigon J RNA [details] 16373493 -

Links:

_PubMed_
_SGD_
_Wikipedia - Small nucleolar RNA_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto