Full name: H/ACA ribonucleoprotein complex subunit 2
Synonym: 15.5kD
GI: 59799862
Orf: YDL208W
COG: COG1358
UniProt: P32495
Structures: | |
Complex: H/ACA RNP

Comments:

Nhp2 (15.5kD) protein is a homologue of yeast Snu13 and Archaea L7Ae. Binds to a common kink-turn motif of snoRNA. One of the essential subunits of H/ACA RNP complex catalysing pseudouridine formation in various RNAs and also mediating telomerase maintenance. Is is also a part of the eukaryotic pre-mRNA splicesomal RNP apparatus complex.

Protein sequence:

MGKDNKEHKESKESKTVDNYEARMPAVLPFAKPLASKKLNKKVLKTVKKASKAKNVKRGVKEVVKALRKG EKGLVVIAGDISPADVISHIPVLCEDHSVPYIFIPSKQDLGAAGATKRPTSVVFIVPGSNKKKDGKNKEE EYKESFNEVVKEVQAL

Publications:

Title Authors Journal Details PubMed Id DOI
Sequence and genetic analysis of NHP2: a moderately abundant high mobility group-like nuclear protein with an essential function in Saccharomyces cerevisiae. Kolodrubetz D, Burgum A Yeast [details] 2063628 -
Reconstitution and structural analysis of the yeast box H/ACA RNA-guided pseudouridine synthase. Li S, Duan J, Li D, Yang B, Dong M, Ye K Genes Dev [details] 22085967 -
Cbf5p, the putative pseudouridine synthase of H/ACA-type snoRNPs, can form a complex with Gar1p and Nop10p in absence of Nhp2p and box H/ACA snoRNAs. Henras AK, Capeyrou R, Henry Y, Caizergues-Ferrer M RNA [details] 15388873 -
Structure of H/ACA RNP protein Nhp2p reveals cis/trans isomerization of a conserved proline at the RNA and Nop10 binding interface. Koo BK, Park CJ, Fernandez CF, Chim N, Ding Y, Chanfreau G, Feigon J... J Mol Biol [details] 21708174 -

Links:

_PubMed_
_Wikipedia - Small nucleolar RNA_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto