MHTMHIPSGDVLIPKPKLITEETDPLHIIKTRQKTHGRPVTIAGPMVRYSKLPFRQLCREYNVDIVYSPMILAREYVRNEHARISDLSTNNEDTPLIVQV GVNNVADLLKFVEMVAPYCDGIGINCGCPIKEQIREGIGCALIYNSDLLCSMVHAVKDKYGDKLRIETKIRIHEALDETVELCRKLCDAGVDWITIHGRT RRTRSSQPANLDAIKYIIENISDKNVPVIANGDCFKLSDLERITKYTGAHGVMAVRGLLSNPALFAGYTTCPWGCIEKFCYWALEFGGLPFQLAQHHLYC MLENMELKKSLLKKMMNLKNYISLIDWFNKTFEFKRYGEDGFGMGVEIPYKANSCVQRSASVVERQE
| Reaction | Substrate | Type | Position |
|---|---|---|---|
| U:D | tRNA (t) | Asn/GUU/prokaryotic cytosol | 20a |
| U:D | tRNA (t) | Glu/CUC/prokaryotic cytosol | 20a |
| U:D | tRNA (t) | Gly/{CC/prokaryotic cytosol | 20a |
| U:D | tRNA (t) | His/GUG/prokaryotic cytosol | 20a |
| U:D | tRNA (t) | Ile/IAU/prokaryotic cytosol | 20a |
| U:D | tRNA (t) | Ile/UAU/prokaryotic cytosol | 20a |
| U:D | tRNA (t) | Leu/UAG/prokaryotic cytosol | 20a |
| U:D | tRNA (t) | Ser/CGA/prokaryotic cytosol | 20a |
| U:D | tRNA (t) | Ser/UGA/prokaryotic cytosol | 20a |
| U:D | tRNA (t) | Ser/IGA/prokaryotic cytosol | 20a |
| U:D | tRNA (t) | Tyr/GUA/prokaryotic cytosol | 20a |
| U:D | tRNA (t) | Val/UAC/prokaryotic cytosol | 20a |
| U:D | tRNA (t) | Val/CAC/prokaryotic cytosol | 20a |
| U:D | tRNA (t) | Val/IAC/prokaryotic cytosol | 20a |
| U:D | tRNA (t) | Leu/UAG/prokaryotic cytosol | 20b |
| U:D | tRNA (t) | Leu/CAA/prokaryotic cytosol | 20b |
| U:D | tRNA (t) | Leu/UAA/prokaryotic cytosol | 20b |
| U:D | tRNA (t) | Tyr/GUA/prokaryotic cytosol | 20b |
| Title | Authors | Journal | Details | ||
|---|---|---|---|---|---|
| The specificities of four yeast dihydrouridine synthases for cytoplasmic tRNAs. | Xing F, Hiley SL, Hughes TR, Phizicky EM | J Biol Chem | [details] | 14970222 | - |
| A conserved family of Saccharomyces cerevisiae synthases effects dihydrouridine modification of tRNA. | Xing F, Martzen MR, Phizicky EM | RNA | [details] | 12003496 | - |
| Molecular evolution of dihydrouridine synthases. | Kasprzak JM, Czerwoniec A, Bujnicki JM... | BMC Bioinformatics | [details] | 22741570 | - |
| _Wikipedia_ |
| _PubMed_ |