Full name: tRNA-dihydrouridine synthase 4
Synonym:
GI: 2833204
Orf: YLR405W, L8084.2
COG: COG0042
UniProt: Q06063
Structures: | |
Complex:
Enzyme type: dihydrouridine synthase
Position of modification - modification: t:20a - D
t:20b - D

Comments:

Dus4, like Dus2, catalyzes the D formation of tRNA through reduction of uracil base with flavin mononucleotide (FMN) as a cofactor. Not essential enzyme.

Protein sequence:

MHTMHIPSGDVLIPKPKLITEETDPLHIIKTRQKTHGRPVTIAGPMVRYSKLPFRQLCREYNVDIVYSPM ILAREYVRNEHARISDLSTNNEDTPLIVQVGVNNVADLLKFVEMVAPYCDGIGINCGCPIKEQIREGIGC ALIYNSDLLCSMVHAVKDKYGDKLRIETKIRIHEALDETVELCRKLCDAGVDWITIHGRTRRTRSSQPAN LDAIKYIIENISDKNVPVIANGDCFKLSDLERITKYTGAHGVMAVRGLLSNPALFAGYTTCPWGCIEKFC YWALEFGGLPFQLAQHHLYCMLENMELKKSLLKKMMNLKNYISLIDWFNKTFEFKRYGEDGFGMGVEIPY KANSCVQRSASVVERQE

Enzymatic activities:

Reaction Substrate Type Position
U:D tRNA (t) Asn/GUU/prokaryotic cytosol 20a
U:D tRNA (t) Glu/CUC/prokaryotic cytosol 20a
U:D tRNA (t) Gly/{CC/prokaryotic cytosol 20a
U:D tRNA (t) His/GUG/prokaryotic cytosol 20a
U:D tRNA (t) Ile/IAU/prokaryotic cytosol 20a
U:D tRNA (t) Ile/UAU/prokaryotic cytosol 20a
U:D tRNA (t) Leu/UAG/prokaryotic cytosol 20a
U:D tRNA (t) Ser/CGA/prokaryotic cytosol 20a
U:D tRNA (t) Ser/UGA/prokaryotic cytosol 20a
U:D tRNA (t) Ser/IGA/prokaryotic cytosol 20a
U:D tRNA (t) Tyr/GUA/prokaryotic cytosol 20a
U:D tRNA (t) Val/UAC/prokaryotic cytosol 20a
U:D tRNA (t) Val/CAC/prokaryotic cytosol 20a
U:D tRNA (t) Val/IAC/prokaryotic cytosol 20a
U:D tRNA (t) Leu/UAG/prokaryotic cytosol 20b
U:D tRNA (t) Leu/CAA/prokaryotic cytosol 20b
U:D tRNA (t) Leu/UAA/prokaryotic cytosol 20b
U:D tRNA (t) Tyr/GUA/prokaryotic cytosol 20b

Publications:

Title Authors Journal Details PubMed Id DOI
The specificities of four yeast dihydrouridine synthases for cytoplasmic tRNAs. Xing F, Hiley SL, Hughes TR, Phizicky EM J Biol Chem [details] 14970222 -
A conserved family of Saccharomyces cerevisiae synthases effects dihydrouridine modification of tRNA. Xing F, Martzen MR, Phizicky EM RNA [details] 12003496 -
Molecular evolution of dihydrouridine synthases. Kasprzak JM, Czerwoniec A, Bujnicki JM... BMC Bioinformatics [details] 22741570 -

Links:

_Wikipedia_
_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto