Full name: tRNA-dihydrouridine synthase 3
Synonym:
GI: 547573
Orf: YLR401C
COG:
UniProt: Q06053
Structures: | |
Complex:
Enzyme type: dihydrouridine synthase
Position of modification - modification: t:47 - D

Comments:

Dus3 catalyzes the D formation of tRNA through reduction of uracil base with flavin mononucleotide (FMN) as a cofactor. Not essential enzyme. Dus3 modifies all tRNAs with U at position 47, with the exception of tRNAPhe1, Phe2, and Lys1.

Protein sequence:

MEQNAEKRSIVGDDNSTVKRQDTSPSKGIAHIKPEYIVPLKQNENQKVAIYDEEMSSDRMTNEFAGGTNK KNKNGRGKKRGQNKNRDNRQVKEQNVLCPRLIHGDISKCSFGDNCRFVHDINLYLSTKKPEVESNIFPSC PVFNSLGFCPMGFKCRFLSSHLNKEDNILISKKEIDPDAQTIWSVKGEVNHISPERKLDLIKRRFPFTKS NEILEIIDSFQQECRDSMKPEEEVESTPQLKKQDPDVEQPVAPQVEQRNKELSEHRMKQREVYLKYKDTR YFAQEKKPLDLYHKKIVSPLTTVGNLPYRRLMRKLGADVTYSEMALAVPLIQGTNSEWALPKAHTSEFPG FGVQVACSKAWQAAKAAEALANSVSEISEINLNSGCPIDLLYRQGSGSALLDNPARMIRCLNAMNYVSKD IPITVKIRTGTKEGHPIAEGLVKRLVNETDVAAITLHGRSRQQRYTKSADWDYVSQVADTLRSAEADFIE TEQGKEGRDSKNRIQFVGNGDVNNFEDWYRYLNGNENIDSVMVARGALIKPWIFEEVESQQYLDKTSTER LDILRDYAQFSMEHWGTDEYGISQCRRFFCEFMSFFHRYVPWVFVKDTL

Enzymatic activities:

Reaction Substrate Type Position
U:D tRNA (t) Ala/IGC/prokaryotic cytosol 47
U:D tRNA (t) Arg/ICG/prokaryotic cytosol 47
U:D tRNA (t) Arg/ICU/prokaryotic cytosol 47
U:D tRNA (t) Asn/GUU/prokaryotic cytosol 47
U:D tRNA (t) Cys/GCA/prokaryotic cytosol 47
U:D tRNA (t) Ile/IAU/prokaryotic cytosol 47
U:D tRNA (t) Ile/UAU/prokaryotic cytosol 47
U:D tRNA (t) Lys/CUU/prokaryotic cytosol 47
U:D tRNA (t) Met/CAU/prokaryotic cytosol 47
U:D tRNA (t) Thr/IGU/prokaryotic cytosol 47
U:D tRNA (t) Trp/CCA/prokaryotic cytosol 47
U:D tRNA (t) Tyr/GUA/prokaryotic cytosol 47
U:D tRNA (t) Val/UAC/prokaryotic cytosol 47
U:D tRNA (t) Val/CAC/prokaryotic cytosol 47
U:D tRNA (t) Val/IAC/prokaryotic cytosol 47
U:D tRNA (t)   47

Publications:

Title Authors Journal Details PubMed Id DOI
The specificities of four yeast dihydrouridine synthases for cytoplasmic tRNAs. Xing F, Hiley SL, Hughes TR, Phizicky EM J Biol Chem [details] 14970222 -
A conserved family of Saccharomyces cerevisiae synthases effects dihydrouridine modification of tRNA. Xing F, Martzen MR, Phizicky EM RNA [details] 12003496 -
Molecular evolution of dihydrouridine synthases. Kasprzak JM, Czerwoniec A, Bujnicki JM... BMC Bioinformatics [details] 22741570 -

Links:

_Wikipedia_
_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto