Full name: tRNA acetyltransferase TAN1
Synonym:
GI: 1723972
Orf: YGL232W
COG: COG1818
UniProt: P53072
Structures: | |
Complex: Rra1/Tan1

Comments:

TAN1 is required for formation of ac4C12 in leucine and serine tRNAs. TAN1 interacts in vivo in yeast cells with RRA1 (KRE33), and, on this basis, was suggested to work as a tRNA adaptor to Kre33, which is a demonstrated catalytically active acetyltransferase. The human homolog of TAN1 is THUMPD1. THUMPD1 interacts in vivo with NAT10, the human homolog of KRE33.

Protein sequence:

MGEKRNRNGKDANSQNRKKFKVSSGFLDPGTSGIYATCSRRHERQAAQELQLLFEEKFQELYGDIKEGED ESENDEKKDLSIEDQIKKELQELKGEETGKDLSSGETKKKDPLAFIDLNCECVTFCKTRKPIVPEEFVLS IMKDLADPKNMVKRTRYVQKLTPITYSCNAKMEQLIKLANLVIGPHFHDPSNVKKNYKFAVEVTRRNFNT IERMDIINQVVKLVNKEGSEFNHTVDLKNYDKLILVECFKSNIGMCVVDGDYKTKYRKYNVQQLYESKFR KDEDKSVKQ

Publications:

Title Authors Journal Details PubMed Id DOI
The Saccharomyces cerevisiae TAN1 gene is required for N4-acetylcytidine formation in tRNA. Johansson MJ, Bystrom AS RNA [details] 15037780 -
Yeast Kre33 and human NAT10 are conserved 18S rRNA cytosine acetyltransferases that modify tRNAs assisted by the adaptor Tan1/THUMPD1. Sharma S, Langhendries JL, Watzinger P, Kotter P, Entian KD, Lafontaine DL... Nucleic Acids Res [details] 25653167 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto