Modomics - A Database of RNA Modifications

Full name:	Ribosomal RNA small subunit methyltransferase B
Synonym:	Fmu/Fmv, RrmB, Sun, YhdB
GI:	1169715
Orf:	b3289
COG:	COG0144
UniProt:	P36929
Structures:	\| 1SQF \| 1SQG \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	s:967(967) - m5C

Comments:

RsmB catalyzes the site-specific formation of m5C at position 967 in a loop of hairpin 31 of Domain III in unmodified 16S rRNA transcript. A 16mer mini-substrate encompassing the stem-loop 31 containing the target C967 can also be methylated in vitro, while neither 30S ribosomal subunit nor transcripts of 23S rRNA are substrates for RsmB. AdoMet is the methyl group donor. There is no requirement for Mg. RsmB contains three subdomains which share structural homology to DNA m5C methyltransferases, other AdoMet-dependent methyltransferases and two RNA binding protein families. In Fungi, the homologous gene is Nop2 (RsmB) and in human cell it is the tumor-specific nucleolar proliferation-associated protein P120. RsmB belongs to the same family as E.coli RsmF, yeast Nop2, yeast and archaeal Trm4, Homo sapiens NSUN1 (P120), NSUN2, NSUN3 and NSUN4 (The acronym RsmB has also been used for Regulator of Secondary Metabolism B, a protein not related to RNA small subunit Methyltransferase B).

Protein sequence:

MKKQRNLRSMAAQAVEQVVEQGQSLSNILPPLQQKVSDKDKALLQELCFGVLRTLSQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALA
ETVEGAIAIKRPQLKGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPMWLRINRTHHSRDSWLALLDEAGMKGF
PHADYPDAVRLETPAPVHALPGFEDGWVTVQDASAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRLGMKATVK
QGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQLQSEILDAIWPHLKTGGTLVYATCSVLPEENSLQIKAFLQRTADAELCE
TGTPEQPGKQNLPGAEEGDGFFYAKLIKK

Enzymatic activities:

Reaction	Substrate	Type	Position
C:m5C	rRNA (r)	SSU/16S/prokaryotic cytosol	967

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Identification of the 16S rRNA m5C967 methyltransferase from Escherichia coli.	Gu XR, Gustafsson C, Ku J, Yu M, Santi DV	Biochemistry	[details]	10194318	-
Purification, cloning, and characterization of the 16S RNA m5C967 methyltransferase from Escherichia coli.	Tscherne JS, Nurse K, Popienick P, Michel H, Sochacki M, Ofengand J	Biochemistry	[details]	10026269	-
The first structure of an RNA m5C methyltransferase, Fmu, provides insight into catalytic mechanism and specific binding of RNA substrate.	Foster PG, Nunes CR, Greene P, Moustakas D, Stroud RM	Structure	[details]	14656444	-
A paradigm for local conformational control of function in the ribosome: binding of ribosomal protein S19 to Escherichia coli 16S rRNA in the presence of S7 is required for methylation of m2G966 and blocks methylation of m5C967 by their respective methyltransferases.	Weitzmann C, Tumminia SJ, Boublik M, Ofengand J	Nucleic Acids Res	[details]	1766869	-