Modomics - A Database of RNA Modifications

Full name: Ribosomal RNA small subunit methyltransferase C
Synonym: YjjT
GI: 732118
Orf: yjjT, b4371
COG: COG2813
UniProt: P39406
Structures: | 2PJD |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: s:1207(1207) - m2G

Comments:

RsmC catalyzes the transfer of a methyl group from S-adenosyl-l-methionine (SAM) to G1207 in hairpin 34 of 16S rRNA (m2G1207). It has two homologous domains tandemly duplicated within a single polypeptide. The enzyme reacts well with 30S subunits reconstituted from 16S RNA transcripts and 30S proteins, but is almost inactive with the corresponding free RNA. E. coli RsmC is closely related to E. coli RsmD (m2G966/16S rRNA) and also to a family of other MTases from Gram-positive bacteria and Archaea, typified by the Mj0882 protein from M. jannaschii (1dus in PDB) (The acronym RsmC has also been used for for ‘Regulator of Secondary Metabolism C’, a protein not related to Ribosomal small subunit Methyltransferase C).

Protein sequence:

MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLSRQMGDNARFSLVATADDVADCDTLIYYWPKNKPEAQFQLMNLLS
LLPVGTDIFVVGENRSGVRSAEQMLADYAPLNKVDSARRCGLYFGRLEKQPVFDAEKFWGEYSVDGLTVKTLPGVFSRDGLDVGSQLLLSTLTPHTKGKV
LDVGCGAGVLSVAFARHSPKIRLTLCDVSAPAVEASRATLAANGVEGEVFASNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELR
IVANAFLPYPDVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG

Enzymatic activities:

Reaction Substrate Type Position
G:m2G rRNA (r) SSU/16S/prokaryotic cytosol 1207

Publications:

Title Authors Journal Details PubMed Id DOI
Functional specialization of domains tandemly duplicated within 16S rRNA methyltransferase RsmC. Sunita S, Purta E, Durawa M, Tkaczuk KL, Swaathi J, Bujnicki JM, Sivaraman J Nucleic Acids Res [details] 17576679 -
Phylogenomic analysis of 16S rRNA:(guanine-N2) methyltransferases suggests new family members and reveals highly conserved motifs and a domain structure similar to other nucleic acid amino-methyltransferases. Bujnicki JM FASEB J [details] 11053259 -
Ribosomal RNA guanine-(N2)-methyltransferases and their targets. Sergiev PV, Bogdanov AA, Dontsova OA Nucleic Acids Res [details] 17389639 -
RNA:(guanine-N2) methyltransferases RsmC/RsmD and their homologs revisited--bioinformatic analysis and prediction of the active site based on the uncharacterized Mj0882 protein structure. Bujnicki JM, Rychlewski L BMC Bioinformatics [details] 11929612 -
Purification, cloning, and characterization of the 16 S RNA m2G1207 methyltransferase from Escherichia coli. Tscherne JS, Nurse K, Popienick P, Ofengand J J Biol Chem [details] 9873033 -

Links:

_BRENDA_
_KEGG_

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca