Full name: Ribosomal RNA small subunit methyltransferase D
Synonym: YhhF
GI: 83288061
Orf: b3465, JW3430
COG: COG0742
UniProt: P0ADX9
Structures: | 2FPO |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: s:966(966) - m2G

Comments:

This methyltransferase catalyzes the formation of m2G966 in the loop of hairpin 31 of 16S rRNA within a pre-30S ribosome. A purified complex containing stoichiometric amounts of proteins S7, S9, and S19 bound to 16S rRNA possess the same RsmD methylation properties as 30S subunits. Structure of E.coli RsmD methyltransferase was determined and compared with the one of the M. jannaschii RsmC ortholog, specific for m2G1207 of the same 16S rRNA. RsmD and RsmC both posses a common MTase domain in the C-terminus (Rossmann-fold) and a variable region in the N-terminus that is related to the YbiN family of MTases (formation of m6A1618 by RlmF). Sequence/structure comparison suggests that both rRNA:m2G MTases are very closely related to RNA and DNA:m6A MTases and that these two enzyme families share common architecture of the active site and presumably a similar mechanism of methyl group transfer onto the exocyclic amino group of their target bases. Notice, adjacent to G966, a m5C967 has been found. The corresponding E. coli RsmB enzyme catalyzing m5C967 synthesis works in vitro only on free 16S rRNA; the presence of ribosomal proteins S7, S9 and S19 inhibit formation of m5C967 in vitro.

Protein sequence:

MKKPNHSGSGQIRIIGGQWRGRKLPVPDSPGLRPTTDRVRETLFNWLAPVIVDAQCLDCFAGSGALGLEA LSRYAAGATLIEMDRAVSQQLIKNLATLKAGNARVVNSNAMSFLAQKGTPHNIVFVDPPFRRGLLEETIN LLEDNGWLADEALIYVESEVENGLPTVPANWSLHREKVAGQVAYRLYQREAQGESDAD

Enzymatic activities:

Reaction Substrate Type Position
G:m2G rRNA (r) SSU/16S/prokaryotic cytosol 966

Publications:

Title Authors Journal Details PubMed Id DOI
Methyltransferase that modifies guanine 966 of the 16 S rRNA: functional identification and tertiary structure. Lesnyak DV, Osipiuk J, Skarina T, Sergiev PV, Bogdanov AA, Edwards A, Savchenko A, Joachimiak A, Dontsova OA J Biol Chem [details] 17189261 -
Ribosomal RNA guanine-(N2)-methyltransferases and their targets. Sergiev PV, Bogdanov AA, Dontsova OA Nucleic Acids Res [details] 17389639 -
RNA:(guanine-N2) methyltransferases RsmC/RsmD and their homologs revisited--bioinformatic analysis and prediction of the active site based on the uncharacterized Mj0882 protein structure. Bujnicki JM, Rychlewski L BMC Bioinformatics [details] 11929612 -
Properties of small rRNA methyltransferase RsmD: Mutational and kinetic study. Sergeeva OV, Prokhorova IV, Ordabaev Y, Tsvetkov PO, Sergiev PV, Bogdanov AA, Makarov AA, Dontsova OA RNA [details] 22535590 -

Links:

_BRENDA_
_KEGG_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto