Full name: preQ1 synthase
Synonym: YgcD
GI: 2495654
Orf: yqcD, b2794
COG: COG2904
UniProt: Q46920
Structures: | |
Complex:
Enzyme type: oxidoreductase
Position of modification - modification: t:34 - QtRNA

Comments:

Reaction preQ0base:preQ0 does not occur under physiological conditions, because normally all preQ0(b) is converted to preQ1(b) by QueF.

Protein sequence:

MSSYANHQALAGLTLGKSTDYRDTYDASLLQGVPRSLNRDPLGLKADNLPFHGTDIWTLYELSWLNAKGL PQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFNNWDEVRQTLERDLSTCAQGKISVALYRLDELEGQ PIGHFNGTCIDDQDITIDNYEFTTDYLENATCGEKVVEETLVSHLLKSNCLITHQPDWGSLQIQYRGRQI DREKLLRYLVSFRHHNEFHEQCVERIFNDLLRFCQPEKLSVYARYTRRGGLDINPWRSNSDFVPSTTRLV RQ

Enzymatic activities:

Reaction Substrate Type Position
preQ0base:preQ1base     None

Publications:

Title Authors Journal Details PubMed Id DOI
From cyclohydrolase to oxidoreductase: discovery of nitrile reductase activity in a common fold. Van Lanen SG, Reader JS, Swairjo MA, de Crecy-Lagard V, Lee B, Iwata-Reuyl D Proc Natl Acad Sci U S A [details] 15767583 -
Identification of four genes necessary for biosynthesis of the modified nucleoside queuosine. Reader JS, Metzgar D, Schimmel P, de Crecy-Lagard V J Biol Chem [details] 14660578 -

Links:

_EcoCyc_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto