Modomics - A Database of RNA Modifications

ID Card:

Full name: Ribosomal RNA small subunit methyltransferase J
Synonym: YhiQ
GI: 388479744
COG: COG0742
UniProt: P68567
Structures: | 2PGX |
Enzyme type: methyltransferase
Position of modification - modification: s:1516(1516) - m2G


PDB Structures:


2PGX

Structure Description:

Title:
Classification:
Technique:

Abstract of the PDB Structure's related Publication:



Download RCSB-PDB Structures:

Pdb Files   2PGX.pdb  
Pdbx/mmCIF Files   2PGX.cif  


Protein sequence:

MKICLIDETGAGDGALSVLAARWGLEHDEDNLMALVLTPEHLELRKRDEPKLGGIFVDFVGGAMAHRRKFGGGRGEAVAKAVGIKGDYLPDVVDATAGLGRDAFVLASVGCRVRMLERNPVVAALLDDGLARGYADAEIGGWLQERLQLIHASSLTALTDITPRPQVVYLDPMFPHKQKSALVKKEMRVFQSLVGPDLDADGLLEPARLLATKRVVVKRPDYAPPLANVATPNAVVTKGHRFDIYAGTPV

Comments:

RsmJ catalyzes formation of m2G1516 in the loop of hairpin 45 at the 3’-end of 16S ribosomal RNA. Recombinant RsmJ specifically methylates 30S subunits extracted from the deletion strain. All ribosomal guanine-(N2)-methyltransferases have similar AdoMet-binding sites. Moreover, comparative sequence analysis supported by sequence/structure threading suggests that rRNA:m2G MTases are very closely related to RNA and DNA:m6A MTases and that these two enzyme families share common architecture of the active site and presumably a similar mechanism of methyl group transfer onto the exocyclic amino group of their target bases.




Reaction Substrate SubstrateType Position (Anti)Codon Modified (Anti)Codon Amino Acid Change Transcript Name Transcript Region Cellular Localization References
G:m2G RNA rRNA 1516 SSU-16S Prokaryotic Cytosol



Publications:

Title Authors Journal Details PubMed Id DOI
Phylogenomic analysis of 16S rRNA:(guanine-N2) methyltransferases suggests new family members and reveals highly conserved motifs and a domain structure similar to other nucleic acid amino-methyltransferases. Bujnicki JM FASEB J [details] 11053259 -
Ribosomal RNA guanine-(N2)-methyltransferases and their targets. Sergiev PV, Bogdanov AA, Dontsova OA Nucleic Acids Res [details] 17389639 -
YhiQ Is RsmJ, the Methyltransferase Responsible for Methylation of G1516 in 16S rRNA of E. coli. Basturea GN, Dague DR, Deutscher MP, Rudd KE J Mol Biol [details] 22079366 -