Modomics - A Database of RNA Modifications

Full name:	Ribosomal RNA small subunit methyltransferase J
Synonym:	YhiQ
GI:	388479744
Orf:
COG:	COG0742
UniProt:	P68567
Structures:	\| 2PGX \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	s:1516(1516) - m2G

Comments:

RsmJ catalyzes formation of m2G1516 in the loop of hairpin 45 at the 3’-end of 16S ribosomal RNA. Recombinant RsmJ specifically methylates 30S subunits extracted from the deletion strain. All ribosomal guanine-(N2)-methyltransferases have similar AdoMet-binding sites. Moreover, comparative sequence analysis supported by sequence/structure threading suggests that rRNA:m2G MTases are very closely related to RNA and DNA:m6A MTases and that these two enzyme families share common architecture of the active site and presumably a similar mechanism of methyl group transfer onto the exocyclic amino group of their target bases.

Protein sequence:

MKICLIDETGAGDGALSVLAARWGLEHDEDNLMALVLTPEHLELRKRDEPKLGGIFVDFVGGAMAHRRKFGGGRGEAVAKAVGIKGDYLPDVVDATAGLG
RDAFVLASVGCRVRMLERNPVVAALLDDGLARGYADAEIGGWLQERLQLIHASSLTALTDITPRPQVVYLDPMFPHKQKSALVKKEMRVFQSLVGPDLDA
DGLLEPARLLATKRVVVKRPDYAPPLANVATPNAVVTKGHRFDIYAGTPV

Enzymatic activities:

Reaction	Substrate	Type	Position
G:m2G	rRNA (r)	SSU/16S/prokaryotic cytosol	1516

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Phylogenomic analysis of 16S rRNA:(guanine-N2) methyltransferases suggests new family members and reveals highly conserved motifs and a domain structure similar to other nucleic acid amino-methyltransferases.	Bujnicki JM	FASEB J	[details]	11053259	-
Ribosomal RNA guanine-(N2)-methyltransferases and their targets.	Sergiev PV, Bogdanov AA, Dontsova OA	Nucleic Acids Res	[details]	17389639	-
YhiQ Is RsmJ, the Methyltransferase Responsible for Methylation of G1516 in 16S rRNA of E. coli.	Basturea GN, Dague DR, Deutscher MP, Rudd KE	J Mol Biol	[details]	22079366	-