Full name: Ribosomal RNA small subunit methyltransferase J
Synonym: YhiQ
GI: 388479744
Orf:
COG: COG0742
UniProt: P68567
Structures: | 2PGX |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: s:1516(1516) - m2G

Comments:

RsmJ catalyzes formation of m2G1516 in the loop of hairpin 45 at the 3’-end of 16S ribosomal RNA. Recombinant RsmJ specifically methylates 30S subunits extracted from the deletion strain. All ribosomal guanine-(N2)-methyltransferases have similar AdoMet-binding sites. Moreover, comparative sequence analysis supported by sequence/structure threading suggests that rRNA:m2G MTases are very closely related to RNA and DNA:m6A MTases and that these two enzyme families share common architecture of the active site and presumably a similar mechanism of methyl group transfer onto the exocyclic amino group of their target bases.

Protein sequence:

MKICLIDETGAGDGALSVLAARWGLEHDEDNLMALVLTPEHLELRKRDEPKLGGIFVDFVGGAMAHRRKF GGGRGEAVAKAVGIKGDYLPDVVDATAGLGRDAFVLASVGCRVRMLERNPVVAALLDDGLARGYADAEIG GWLQERLQLIHASSLTALTDITPRPQVVYLDPMFPHKQKSALVKKEMRVFQSLVGPDLDADGLLEPARLL ATKRVVVKRPDYAPPLANVATPNAVVTKGHRFDIYAGTPV

Enzymatic activities:

Reaction Substrate Type Position
G:m2G rRNA (r) SSU/16S/prokaryotic cytosol 1516

Publications:

Title Authors Journal Details PubMed Id DOI
Phylogenomic analysis of 16S rRNA:(guanine-N2) methyltransferases suggests new family members and reveals highly conserved motifs and a domain structure similar to other nucleic acid amino-methyltransferases. Bujnicki JM FASEB J [details] 11053259 -
Ribosomal RNA guanine-(N2)-methyltransferases and their targets. Sergiev PV, Bogdanov AA, Dontsova OA Nucleic Acids Res [details] 17389639 -
YhiQ Is RsmJ, the Methyltransferase Responsible for Methylation of G1516 in 16S rRNA of E. coli. Basturea GN, Dague DR, Deutscher MP, Rudd KE J Mol Biol [details] 22079366 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto