Full name: Cysteine desulfurase, mitochondrial
Synonym: Spl1
GI: 45644965
Orf: YCL017C
COG: COG1104
UniProt: P25374
Structures: | |
Complex:
Enzyme type: cysteine desulfurase
Position of modification - modification:

Comments:

Nfs1 is the eukaryal ortholog of bacterial IscS. This sulfur donor protein contains a pyridoxal phosphate cofactor and is involved in the formation of s2U at position 34 of anticodon in both cytoplasmic and mitochondrial tRNAs. In mitochondria, it forms a strong complex with Lsd11p. In the cytoplasm, the subsequent sulphur cascade relay system is very different from the one in mitochondria (see Urm1, Uba4 and Tum1).

Protein sequence:

MLKSTATRSITRLSQVYNVPAATYRACLVSRRFYSPPAAGVKLDDNFSLETHTDIQAAAKAQASARASAS GTTPDAVVASGSTAMSHAYQENTGFGTRPIYLDMQATTPTDPRVLDTMLKFYTGLYGNPHSNTHSYGWET NTAVENARAHVAKMINADPKEIIFTSGATESNNMVLKGVPRFYKKTKKHIITTRTEHKCVLEAARAMMKE GFEVTFLNVDDQGLIDLKELEDAIRPDTCLVSVMAVNNEIGVIQPIKEIGAICRKNKIYFHTDAAQAYGK IHIDVNEMNIDLLSISSHKIYGPKGIGAIYVRRRPRVRLEPLLSGGGQERGLRSGTLAPPLVAGFGEAAR LMKKEFDNDQAHIKRLSDKLVKGLLSAEHTTLNGSPDHRYPGCVNVSFAYVEGESLLMALRDIALSSGSA CTSASLEPSYVLHALGKDDALAHSSIRFGIGRFSTEEEVDYVVKAVSDRVKFLRELSPLWEMVQEGIDLN SIKWSGH

Publications:

Title Authors Journal Details PubMed Id DOI
SPL1-1, a Saccharomyces cerevisiae mutation affecting tRNA splicing. Kolman C, Soll D J Bacteriol [details] 8444805 -
Yeast Nfs1p is involved in thio-modification of both mitochondrial and cytoplasmic tRNAs. Nakai Y, Umeda N, Suzuki T, Nakai M, Hayashi H, Watanabe K, Kagamiyama H J Biol Chem [details] 14722066 -
Human mitochondrial tRNAs: biogenesis, function, structural aspects, and diseases. Suzuki T, Nagao A, Suzuki T Annu Rev Genet [details] 21910628 -
Functional characterization of the eukaryotic cysteine desulfurase Nfs1p from Saccharomyces cerevisiae. Muhlenhoff U, Balk J, Richhardt N, Kaiser JT, Sipos K, Kispal G, Lill R... J Biol Chem [details] 15220327 -
Isd11p protein activates the mitochondrial cysteine desulfurase Nfs1p protein. Pandey A, Yoon H, Lyver ER, Dancis A, Pain D... J Biol Chem [details] 21908622 -

Links:

_SGD_
_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto