Modomics - A Database of RNA Modifications

Full name:	Ribosomal RNA small subunit methyltransferase H
Synonym:	mraW
GI:	42560200
Orf:
COG:	COG0275
UniProt:	P60390
Structures:	\| 3TKA \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	s:1402(1402) - m4Cm

Comments:

RsmH methylates N4 atom of C1402 (m4C) within a heavily hypermodified region of helix 44 in the 3’-terminal region of 16S rRNA. AdoMet is the methyl group donor. This enzyme is conserved in almost all species of bacteria. Together with 2’-O-methyltransferase RsmI, it allows the formation of the final product m4Cm. Phylogenetic profiling (co-occurrence) reavealed probable biochemical links between RsmH and translation factors IF2, RF1 and LepA.

Protein sequence:

MMENYKHTTVLLDEAVNGLNIRPDGIYIDGTFGRGGHSRLILSQLGEEGRLLAIDRDPQAIAVAKTIDDPRFSIIHGPFSALGEYVAERDLIGKIDGILL
DLGVSSPQLDDAERGFSFMRDGPLDMRMDPTRGQSAAEWLQTAEEADIAWVLKTYGEERFAKRIARAIVERNREQPMTRTKELAEVVAAATPVKDKFKHP
ATRTFQAVRIWVNSELEEIEQALKSSLNVLAPGGRLSIISFHSLEDRIVKRFMRENSRGPQVPAGLPMTEEQLKKLGGRQLRALGKLMPGEEEVAENPRA
RSSVLRIAERTNA

Enzymatic activities:

Reaction	Substrate	Type	Position
Cm:m4Cm	rRNA (r)	SSU/16S/prokaryotic cytosol	1402
C:m4C	rRNA (r)	SSU/16S/prokaryotic cytosol	1402
m4C:m4,4C	rRNA (r)	SSU/16S/prokaryotic cytosol	1402
m4Cm:m4,4Cm	rRNA (r)	SSU/16S/prokaryotic cytosol	1402

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Fine-tuning of the ribosomal decoding center by conserved methyl-modifications in the Escherichia coli 16S rRNA.	Kimura S, Suzuki T	Nucleic Acids Res	[details]	19965768	-
RNA nucleotide methylation.	Motorin Y, Helm M.	Wiley Interdiscip Rev RNA	[details]	21823225	-
Crystal and solution structures of methyltransferase RsmH provide basis for methylation of C1402 in 16S rRNA.	Wei Y, Zhang H, Gao ZQ, Wang WJ, Shtykova EV, Xu JH, Liu QS, Dong YH...	J Struct Biol	[details]	22561317	-