Full name: tRNA (uridine-O(2)-)-methyltransferase
Synonym:
GI: 6325227
Orf: YPL030w
COG: COG2227
UniProt: Q02648
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:44 - Um

Comments:



Protein sequence:

MTGDGSAHISKNNQNQHKDRFKFIVNDKSILGPQWLSLYQTDGKVTFAKSHFEQAMMNVIREPNINSTVI LRADILKEINHAAEAGSEPKFDESVLKKFEIDNGNESGEEDVKKINIEDLNIRSCETSESLKLSPVHEFV RRIIPRNFYKDAIINQTCLILNSKDPNFQETSLIVYTPHINSEKDCPFYIPRTQSVGILLHQSVLSVHYI PFPEDKTAFTDESERVVRTAYRLLQTANKHSKGVMQGYEKRVNHDQVVNKVNFQNTYIVLKKKYSKFLVE NWAESTDPKKHVFEDIAIAAFLIELWIKVYGPDFRSKMQFRDLGCGNGALCYILLSESIKGLGIDARKRK SWSIYPPEVQSSLKEQVIIPSILLRPHPALKRQVPHLEHNGRFFPVKVTHEVIAPATVVYSSEDLLKSPQ VNTAEFPPDTFIIGNHSDELTCWIPLLGHPYMVIPCCSHNFSGQRVRFNVRKRSPRSNEIKNQNNSKSTY SGLVDHVEYISSRVGWKVEKEMLRIPSTRNAAIIGVENATLKHFPTQAVYDMIWEDGGAEGWIQNTMSLL KRNPRNH

Enzymatic activities:

Reaction Substrate Type Position
U:Um tRNA (t)   44

Publications:

Title Authors Journal Details PubMed Id DOI
Identification of yeast tRNA Um(44) 2'-O-methyltransferase (Trm44) and demonstration of a Trm44 role in sustaining levels of specific tRNA(Ser) species. Kotelawala L, Grayhack EJ, Phizicky EM RNA [details] 18025252 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto