Full name: Mitochondrial translation optimization protein 1
Synonym: Ips1
GI: 115502421
Orf: YGL236C
COG: COG0445
UniProt: P53070
Structures: | |
Complex: Mto1/Mss1
Enzyme type: other
Position of modification - modification: t:34 - cmnm5s2U

Comments:

Yeast mitochondrial homolog of bacterial MnmG (GidA). Favoprotein. Makes a stable complex with Mss1p. Does not work on cytoplasmic tRNAs. Belongs to the bacterial gidA family but is distinct from bacterial Gid, renamed TrmFO.

Protein sequence:

MLRVTTLASSCTSFPLQVLRRRLTISSLTSFQPTTKTQVVVIGAGHAGCEAAAASSRTGAHTTLITPSLT DIGKCSCNPSIGGVGKGILVKEIDALDGLMGKVTDLAGVQFKMLNRSKGPAVWGPRAQIDRELYKKYMQR ELSDKKAHPNLSLLQNKVADLILYDPGCGHKVIKGVVLDDGTQVGADQVIITTGTFLSAEIHIGDKRIAA GRIGEQPTYGISNTLQNEVGFQLGRLKTGTPARLAKESIDFSALEVQKGDALPVPMSFLNETVSVEPTKQ LDCFGTHTTPQMHDFLRNNLHQSIHIQDTTIKGPRYCPSIEAKILRFPDRSSHKIWLEPEGFNSDVIYPN GISNSMPEDVQLQMMRLIPGMANVEILQPAYGVEYDYVDPRQLKPSLETKLVDGLFLAGQINGTTGYEEA AAQGIIAGINAGLLSRQEREQLVLKRSEAYIGVLIDDLINNGVIEPYRMFTSRSEFRISVRADNADFRLT PIGAQLGIISPVRLSQYSRDKHLYDETIRALQNFKLSSQKWSSLLQANIAPQAENRSAWEIFRFKDMDLH KLYECIPDLPINLLDIPMHVVTKINIQGKYEPYIVKQNQFVKAFQADENMLLPQDYDYRQLPTLSTECKL LLNRVQPLTIGQARRIQGITAAALFELYRVARKPSQPVM

Enzymatic activities:

Reaction Substrate Type Position
s2U:cmnm5s2U tRNA (t) Leu/UAA/mitochondrial 34
U:cmnm5U tRNA (t) 34

Publications:

Title Authors Journal Details PubMed Id DOI
MTO1 codes for a mitochondrial protein required for respiration in paromomycin-resistant mutants of Saccharomyces cerevisiae. Colby G, Wu M, Tzagoloff A J Biol Chem [details] 9774408 -
Mitochondria-specific RNA-modifying enzymes responsible for the biosynthesis of the wobble base in mitochondrial tRNAs. Implications for the molecular pathogenesis of human mitochondrial diseases. Umeda N, Suzuki T, Yukawa M, Ohya Y, Shindo H, Watanabe K, Suzuki T J Biol Chem [details] 15509579 -

Links:

_SGD_
_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto