Full name: Small RNA 2′-O-methyltransferase
Synonym: CORYMBOSA 2, HUA ENHANCER 1
GI: 15638615
Orf: T13K14.70
COG: COG2227
UniProt: Q9C5Q8
Structures: | 3HTX |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: miRNA:3' end - Xm

Comments:

HEN1 deposits the methyl group on to the 2' OH of the 3' terminal nucleotide in double stranded small RNAs. It is a step in miRNA and siRNA metabolism. The modification prevents the 3' uridylation and degradation of the RNA molecule. AdoMet is a methyl group donor. Animal homologue of Hen1 modifies piRNA and is important for germ cell development.

Protein sequence:

MAGGGKHTPTPKAIIHQKFGAKASYTVEEVHDSSQSGCPGLAIPQKGPCLYRCHLQLPEFSVVSNVFKKK KDSEQSAAELALDKLGIRPQNDDLTVDEARDEIVGRIKYIFSDEFLSAEHPLGAHLRAALRRDGERCGSV PVSVIATVDAKINSRCKIINPSVESDPFLAISYVMKAAAKLADYIVASPHGLRRKNAYPSEIVEALATHV SDSLHSREVAAVYIPCIDEEVVELDTLYISSNRHYLDSIAERLGLKDGNQVMISRMFGKASCGSECRLYS EIPKKYLDNSSDASGTSNEDSSHIVKSRNARASYICGQDIHGDAILASVGYRWKSDDLDYDDVTVNSFYR ICCGMSPNGIYKISRQAVIAAQLPFAFTTKSNWRGPLPREILGLFCHQHRLAEPILSSSTAPVKSLSDIF RSHKKLKVSGVDDANENLSRQKEDTPGLGHGFRCEVKIFTKSQDLVLECSPRKFYEKENDAIQNASLKAL LWFSKFFADLDVDGEQSCDTDDDQDTKSSSPNVFAAPPILQKEHSSESKNTNVLSAEKRVQSITNGSVVS ICYSLSLAVDPEYSSDGESPREDNESNEEMESEYSANCESSVELIESNEEIEFEVGTGSMNPHIESEVTQ MTVGEYASFRMTPPDAAEALILAVGSDTVRIRSLLSERPCLNYNILLLGVKGPSEERMEAAFFKPPLSKQ RVEYALKHIRESSASTLVDFGCGSGSLLDSLLDYPTSLQTIIGVDISPKGLARAAKMLHVKLNKEACNVK SATLYDGSILEFDSRLHDVDIGTCLEVIEHMEEDQACEFGEKVLSLFHPKLLIVSTPNYEFNTILQRSTP ETQEENNSEPQLPKFRNHDHKFEWTREQFNQWASKLGKRHNYSVEFSGVGGSGEVEPGFASQIAIFRREA SSVENVAESSMQPYKVIWEWKKEDVEKKKTDL

Publications:

Title Authors Journal Details PubMed Id DOI
Molecular phylogenetics and comparative modeling of HEN1, a methyltransferase involved in plant microRNA biogenesis. Tkaczuk KL, Obarska A, Bujnicki JM BMC Evol Biol [details] 16433904 -
Structural insights into mechanisms of the small RNA methyltransferase HEN1. Huang Y, Ji L, Huang Q, Vassylyev DG, Chen X, Ma JB Nature [details] 19812675 -
Kinetic and functional analysis of the small RNA methyltransferase HEN1: the catalytic domain is essential for preferential modification of duplex RNA. Vilkaitis G, Plotnikova A, Klimasauskas S RNA [details] 20705645 -
Methylation protects miRNAs and siRNAs from a 3'-end uridylation activity in Arabidopsis. Li J, Yang Z, Yu B, Liu J, Chen X Curr Biol [details] 16111943 -
Methylation as a crucial step in plant microRNA biogenesis. Yu B, Yang Z, Li J, Minakhina S, Yang M, Padgett RW, Steward R, Chen X Science [details] 15705854 -
siRNAs compete with miRNAs for methylation by HEN1 in Arabidopsis. Yu B, Bi L, Zhai J, Agarwal M, Li S, Wu Q, Ding SW, Meyers BC, Vaucheret H, Chen X Nucleic Acids Res [details] 20448024 -
HEN1 recognizes 21-24 nt small RNA duplexes and deposits a methyl group onto the 2' OH of the 3' terminal nucleotide. Yang Z, Ebright YW, Yu B, Chen X Nucleic Acids Res [details] 16449203 -
Mechanistic insights into small RNA recognition and modification by the HEN1 methyltransferase. Plotnikova A, Baranauske S, Osipenko A, Klimasauskas S, Vilkaitis G... Biochem J [details] 23621770 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto