Full name: Ribosomal RNA methyltransferase MRM2, mitochondrial
Synonym:
GI: 1723920
Orf: YGL136C
COG: COG0293
UniProt: P53123
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:2791(2552) - Um

Comments:

Mrm2 catalyzes the methylation of 2’-O-ribose of the invariant U2791 (U2552 in E. coli numbering) in the so-called A-loop (hairpin 92) of peptidyl-transferase center (domain V) of 21S mitochondrial rRNA. AdoMet is the methyl donor group. The homologous enzyme in E. coli is RlmE catalyzing formation of Um2552. Notice, equivalent Um2921 in S. cerevisiae cytoplasmic rRNA is catalyzed by C/D RNP machinery (Nop1), using SnR52 as guide-RNA.

Protein sequence:

MILVYNRIRSIISSSLGRIHVRYNSNSQNRWLNRQLKDPYTKEAKVQNLRSRAAFKLMQIDDKYRLFSKN RTDQRILDLGYAPGAWSQVARQRSSPNSMILGVDILPCEPPHGVNSIQANILAKRTHDLIRLFFSKHFQL NRHDDLHKDHGYFQNMLEEELTHVKDTELYREIFTSDDIYETPNTNSTLIEREKFPVDVIISDMYEPWPQ TTGFWNNITNQAYFRMANTSGVSIRDHYQSIDLCDAALVTAIDLLRPLGSFVCKLYTGEEENLFKKRMQA VFTNVHKFKPDASRDESKETYYIGLKKKRNVDKLDVFSNS

Enzymatic activities:

Reaction Substrate Type Position
U:Um rRNA (r) LSU/21S/mitochondrial 2791

Publications:

Title Authors Journal Details PubMed Id DOI
MRM2 encodes a novel yeast mitochondrial 21S rRNA methyltransferase. Pintard L, Bujnicki JM, Lapeyre B, Bonnerot C EMBO J [details] 11867542 -
Molecular phylogenetics of the RrmJ/fibrillarin superfamily of ribose 2'-O-methyltransferases. Feder M, Pas J, Wyrwicz LS, Bujnicki JM Gene [details] 12527203 -
Implications of a functional large ribosomal RNA with only three modified nucleotides. Sirum-Connolly K, Peltier JM, Crain PF, McCloskey JA, Mason TL Biochimie [details] 7541254 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto