Full name: tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase
Synonym:
GI: 67471968
Orf: b0405
COG: COG0809
UniProt: P0A7F9
Structures: | |
Complex:
Enzyme type: isomerase
Position of modification - modification: t:34 - QtRNA

Comments:

AdoMet is the methyl group donor. Ribosyltransferase.

Protein sequence:

MRVTDFSFELPESLIAHYPMPERSSCRLLSLDGPTGALTHGTFTDLLDKLNPGDLLVFNNTRVIPARLFG RKASGGKIEVLVERMLDDKRILAHIRASKAPKPGAELLLGDDESINATMTARHGALFEVEFNDERSVLDI LNSIGHMPLPPYIDRPDEDADRELYQTVYSEKPGAVAAPTAGLHFDEPLLEKLRAKGVEMAFVTLHVGAG TFQPVRVDTIEDHIMHSEYAEVPQDVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKNDLIEPFFDDT QIFIYPGFQYKVVDALVTNFHLPESTLIMLVSAFAGYQHTMNAYKAAVEEKYRFFSYGDAMFITYNPQAI NERVGE

Enzymatic activities:

Reaction Substrate Type Position
preQ1tRNA:oQtRNA tRNA (t)   34

Publications:

Title Authors Journal Details PubMed Id DOI
A new function of S-adenosylmethionine: the ribosyl moiety of AdoMet is the precursor of the cyclopentenediol moiety of the tRNA wobble base queuine. Slany RK, Bosl M, Crain PF, Kersten H Biochemistry [details] 8347586 -

Links:

_EcoCyc_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto