Full name: rRNA methyltransferase, mitochondrial
Synonym: Pet56
GI: 1346886
Orf: YOR201C
COG: COG0566
UniProt: P25270
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:2270(2251) - Gm

Comments:

Mrm1 methylates the universally conserved G2270 in the so-called A-loop (hairpin 92) of the peptidyltransferase center (domain V) of 21S mito rRNA, equivalent to conserved Gm2251 in E. coli 23S rRNA and catalyzed by E. coli RlmB. The purified recombinant Mrm1 enzyme works in vitro on transcripts of both mitochondrial 21S rRNA and E. coli 23S rRNA. AdoMet is the donor of methyl group. In cytoplasmic S. cerevisiae rRNA, the analogous conserved Gm position 2618 (2251 E.coli numbering) is catalyzed at by a C/D box RNP (Nop1), guided by snoR67.

Protein sequence:

MTSLTNAVFKRYLAVTPSAHQALKTRIKKKSSSFDKFFPQQSNSRKKQWETLNEDKASWFKRKYAHVHAR EQDRAADPYGKKKAHVEKLKEIKNQAKLNQKSHKSKFQNKDIALKLMNDNPIFEYVYGTNSVYAALLNPS RNCHSRLLYHGTIPSKFLQIVDELKVTTELVDKHRLNLLTNYGVHNNIALETKPLQPVEIAYLGDMDTSS AALSIHELGFNNENIPHELPYGTKTDAKKFPLGLYLDEITDPHNIGAIIRSAYFLGVDFIVMSRRNCSPL TPVVSKTSSGALELLPIFYVDKPLEFFTKSQEMGGWTFITSHLANATSEKYTVGKTISMHDLNGLCNELP VVLVVGNESQGVRTNLKMRSDFFVEIPFGGIEKGNRAPEPIVDSLNVSVATALLIDNILTCK

Enzymatic activities:

Reaction Substrate Type Position
G:Gm rRNA (r) LSU/21S/mitochondrial 2270

Publications:

Title Authors Journal Details PubMed Id DOI
Functional requirement of a site-specific ribose methylation in ribosomal RNA. Sirum-Connolly K, Mason TL Science [details] 8266080 -

Links:

_PubMed_
_SGD_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto