| Title: | |
|---|---|
| Classification: | |
| Technique: | |
| Pdb Files | 1JSX.pdb   1XDZ.pdb   | 
| Pdbx/mmCIF Files | 1JSX.cif   1XDZ.cif   | 
MLNKLSLLLKDAGISLTDHQKNQLIAYVNMLHKWNKAYNLTSVRDPNEMLVRHILDSIVVAPYLQGERFIDVGTGPGLPGIPLSIVRPEAHFTLLDSLGKRVRFLRQVQHELKLENIEPVQSRVEEFPSEPPFDGVISRAFASLNDMVSWCHHLPGEQGRFYALKGQMPEDEIALLPEEYQVESVVKLQVPALDGERHLVVIKANKI
RsmG is an AdoMet-dependent methyltransferase responsible for the synthesis of m7G527 in the universally conserved loop of hairpin 18 in domain I of bacterial 16S rRNA. Deletion of rsmG gene conferred high-level resistance to the aminoglycoside antibiotics streptomycin and neomycin in Salmonella.
| Reaction | Substrate | SubstrateType | Position | (Anti)Codon | Modified (Anti)Codon | Amino Acid Change | Transcript Name | Transcript Region | Cellular Localization | References | 
|---|---|---|---|---|---|---|---|---|---|---|
| G:m7G | RNA | rRNA | 527 | SSU-16S | Mitochondrion | 
| Title | Authors | Journal | Details | ||
|---|---|---|---|---|---|
| Mutations in rsmG, encoding a 16S rRNA methyltransferase, result in low-level streptomycin resistance and antibiotic overproduction in Streptomyces coelicolor A3(2). | Nishimura K, Hosaka T, Tokuyama S, Okamoto S, Ochi K | J Bacteriol | [details] | 17384192 | - | 
| Regulation of expression and catalytic activity of Escherichia coli RsmG methyltransferase. | Benitez-Paez A, Villarroya M, Armengod ME | RNA | [details] | 22337945 | - | 
| Deletion of gene encoding methyltransferase (gidB) confers high-level antimicrobial resistance in Salmonella. | Mikheil DM, Shippy DC, Eakley NM, Okwumabua OE, Fadl AA | J Antibiot (Tokyo) | [details] | 22318332 | - |