Modomics - A Database of RNA Modifications

ID Card:

Full name:	Ribosomal RNA small subunit methyltransferase G
Synonym:	GidB, JW3718
GI:	62288117
Orf:	b3740
COG:	COG0357
UniProt:	P0A6U5
Structures:	\| 1XDZ \| 1JSX \|
Enzyme type:	methyltransferase
Position of modification - modification:	s:527(527) - m7G

PDB Structures:

1XDZ

Structure Description:

Title:
Classification:
Technique:

Abstract of the PDB Structure's related Publication:

nan

Download RCSB-PDB Structures:

Pdb Files	1JSX.pdb 1XDZ.pdb
Pdbx/mmCIF Files	1JSX.cif 1XDZ.cif

Protein sequence:

MLNKLSLLLKDAGISLTDHQKNQLIAYVNMLHKWNKAYNLTSVRDPNEMLVRHILDSIVVAPYLQGERFIDVGTGPGLPGIPLSIVRPEAHFTLLDSLGKRVRFLRQVQHELKLENIEPVQSRVEEFPSEPPFDGVISRAFASLNDMVSWCHHLPGEQGRFYALKGQMPEDEIALLPEEYQVESVVKLQVPALDGERHLVVIKANKI

Comments:

RsmG is an AdoMet-dependent methyltransferase responsible for the synthesis of m7G527 in the universally conserved loop of hairpin 18 in domain I of bacterial 16S rRNA. Deletion of rsmG gene conferred high-level resistance to the aminoglycoside antibiotics streptomycin and neomycin in Salmonella.

Reaction	Substrate	SubstrateType	Position	(Anti)Codon	Modified (Anti)Codon	Amino Acid Change	Transcript Name	Transcript Region	Cellular Localization	References
G:m7G	RNA	rRNA	527				SSU-16S		Mitochondrion

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Mutations in rsmG, encoding a 16S rRNA methyltransferase, result in low-level streptomycin resistance and antibiotic overproduction in Streptomyces coelicolor A3(2).	Nishimura K, Hosaka T, Tokuyama S, Okamoto S, Ochi K	J Bacteriol	[details]	17384192	-
Regulation of expression and catalytic activity of Escherichia coli RsmG methyltransferase.	Benitez-Paez A, Villarroya M, Armengod ME	RNA	[details]	22337945	-
Deletion of gene encoding methyltransferase (gidB) confers high-level antimicrobial resistance in Salmonella.	Mikheil DM, Shippy DC, Eakley NM, Okwumabua OE, Fadl AA	J Antibiot (Tokyo)	[details]	22318332	-