Modomics - A Database of RNA Modifications

ID Card:

Full name: Ribosomal RNA small subunit methyltransferase G
Synonym: GidB, JW3718
GI: 62288117
Orf: b3740
COG: COG0357
UniProt: P0A6U5
Structures: | 1XDZ | 1JSX |
Enzyme type: methyltransferase
Position of modification - modification: s:527(527) - m7G


PDB Structures:


1XDZ

Structure Description:

Title: Crystal Structure of the Escherichia coli Glucose-Inhibited Division Protein B (GidB)
Classification: UNKNOWN FUNCTION
Technique: X-Ray Diffraction
Resolution: 2.4
R value free: 0.275
R value observed: 0.24
R value work: 0.24

Abstract of the PDB Structure's related Publication:

nan

Download RCSB-PDB Structures:

Pdb Files   1JSX.pdb   1XDZ.pdb  
Pdbx/mmCIF Files   1JSX.cif   1XDZ.cif  


Protein sequence:

MLNKLSLLLKDAGISLTDHQKNQLIAYVNMLHKWNKAYNLTSVRDPNEMLVRHILDSIVVAPYLQGERFIDVGTGPGLPGIPLSIVRPEAHFTLLDSLGKRVRFLRQVQHELKLENIEPVQSRVEEFPSEPPFDGVISRAFASLNDMVSWCHHLPGEQGRFYALKGQMPEDEIALLPEEYQVESVVKLQVPALDGERHLVVIKANKI

Comments:

RsmG is an AdoMet-dependent methyltransferase responsible for the synthesis of m7G527 in the universally conserved loop of hairpin 18 in domain I of bacterial 16S rRNA. Deletion of rsmG gene conferred high-level resistance to the aminoglycoside antibiotics streptomycin and neomycin in Salmonella.







Publications: