Modomics - A Database of RNA Modifications

Full name:	Ribosomal RNA small subunit methyltransferase G
Synonym:	GidB, JW3718
GI:	62288117
Orf:	b3740
COG:	COG0357
UniProt:	P0A6U5
Structures:	\| 1XDZ \| 1JSX \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	s:527(527) - m7G

Comments:

RsmG is an AdoMet-dependent methyltransferase responsible for the synthesis of m7G527 in the universally conserved loop of hairpin 18 in domain I of bacterial 16S rRNA. Deletion of rsmG gene conferred high-level resistance to the aminoglycoside antibiotics streptomycin and neomycin in Salmonella.

Protein sequence:

MLNKLSLLLKDAGISLTDHQKNQLIAYVNMLHKWNKAYNLTSVRDPNEMLVRHILDSIVVAPYLQGERFIDVGTGPGLPGIPLSIVRPEAHFTLLDSLGK
RVRFLRQVQHELKLENIEPVQSRVEEFPSEPPFDGVISRAFASLNDMVSWCHHLPGEQGRFYALKGQMPEDEIALLPEEYQVESVVKLQVPALDGERHLV
VIKANKI

Enzymatic activities:

Reaction	Substrate	Type	Position
G:m7G	rRNA (r)	SSU/16S/prokaryotic cytosol	527

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Mutations in rsmG, encoding a 16S rRNA methyltransferase, result in low-level streptomycin resistance and antibiotic overproduction in Streptomyces coelicolor A3(2).	Nishimura K, Hosaka T, Tokuyama S, Okamoto S, Ochi K	J Bacteriol	[details]	17384192	-
Regulation of expression and catalytic activity of Escherichia coli RsmG methyltransferase.	Benitez-Paez A, Villarroya M, Armengod ME	RNA	[details]	22337945	-
Deletion of gene encoding methyltransferase (gidB) confers high-level antimicrobial resistance in Salmonella.	Mikheil DM, Shippy DC, Eakley NM, Okwumabua OE, Fadl AA	J Antibiot (Tokyo)	[details]	22318332	-