Full name: Ribosomal RNA small subunit methyltransferase E
Synonym: YggJ
GI: 84027953
Orf: b2946
COG: COG1385
UniProt: P0AGL7
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: s:1498(1498) - m3U

Comments:

Purified recombinant E. coli RsmE specifically methylates U1498 into m3U in vitro. This modified base is located in the loop of a conserved hairpin between helix 44 and 45, near the 3′-end of 16S rRNA. Recombinant RsmE is most active in the presence of 10-15 mM Mg2+ and 100 mM NH4Cl. While small ribosome subunits obtained from an RsmE deletion strain can be methylated by purified RsmE, neither 70S ribosomes nor 50S subunits can. This enzyme has an alpha/beta (trefoil) knot and forms dimers in solution.

Protein sequence:

MRIPRIYHPEPLTSHSHIALCEDAANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKKSVEVKVLEGQ IDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLDSERLNKKLQQWQKIAIAACE QCGRNRVPEIRPAMDLEAWCAEQDEGLKLNLHPRASNSINTLPLPVERVRLLIGPEGGLSADEIAMTARY QFTDILLGPRVLRTETTALTAITALQVRFGDLG

Enzymatic activities:

Reaction Substrate Type Position
U:m3U rRNA (r) SSU/16S/prokaryotic cytosol 1498

Publications:

Title Authors Journal Details PubMed Id DOI
Identification and characterization of RsmE, the founding member of a new RNA base methyltransferase family. Basturea GN, Rudd KE, Deutscher MP RNA [details] 16431987 -
Substrate specificity and properties of the Escherichia coli 16S rRNA methyltransferase, RsmE. Basturea GN, Deutscher MP RNA [details] 17872509 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto