Modomics - A Database of RNA Modifications

Full name:	rRNA adenine N-1-methyltransferase
Synonym:	aminoglycoside-resistance 16S rRNA methyltransferase
GI:	157734594
Orf:	npmA
COG:	COG0220
UniProt:	A8C927
Structures:	\| 3P2E \| 3P2I \| 3P2K \| 3PB3 \| 3MTE \| 4OX9 \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	s:1408(1408) - m1A

Comments:

Only in pathogens (KamB family).

Protein sequence:

MLILKGTKTVDLSKDELTEIIGQFDRVHIDLGTGDGRNIYKLAINDQNTFYIGIDPVKENLFDISKKIIKKPSKGGLSNVVFVIAAAESLPFELKNIADS
ISILFPWGTLLEYVIKPNRDILSNVADLAKKEAHFEFVTTYSDSYEEAEIKKRGLPLLSKAYFLSEQYKAELSNSGFRIDDVKELDNEYVKQFNSLWAKR
LAFGRKRSFFRVSGHVSKH

Enzymatic activities:

Reaction	Substrate	Type	Position
A:m1A	rRNA (r)	SSU/16S/prokaryotic cytosol	1408

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Novel plasmid-mediated 16S rRNA m1A1408 methyltransferase, NpmA, found in a clinically isolated Escherichia coli strain resistant to structurally diverse aminoglycosides.	Wachino J, Shibayama K, Kurokawa H, Kimura K, Yamane K, Suzuki S, Shibata N, Ike Y, Arakawa Y	Antimicrob Agents Chemother	[details]	17875999	-
Structural insights into the function of aminoglycoside-resistance A1408 16S rRNA methyltransferases from antibiotic-producing and human pathogenic bacteria.	Macmaster R, Zelinskaya N, Savic M, Rankin CR, Conn GL	Nucleic Acids Res	[details]	20639535	-
Structural basis for the methylation of A1408 in 16S rRNA by a panaminoglycoside resistance methyltransferase NpmA from a clinical isolate and analysis of the NpmA interactions with the 30S ribosomal subunit.	Husain N, Obranic S, Koscinski L, Seetharaman J, Babic F, Bujnicki JM, Maravic-Vlahovicek G, Sivaraman J	Nucleic Acids Res	[details]	21062819	-
Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.	Dunkle JA, Vinal K, Desai PM, Zelinskaya N, Savic M, West DM, Conn GL, Dunham CM...	Proc Natl Acad Sci U S A	[details]	24717845	-