Full name: tRNA 2-thiocytidine(32) synthetase
Synonym: YdaO
GI: 2495598
Orf: b1344
COG: COG0037
UniProt: P76055
Structures: | |
Complex:
Enzyme type: thiolase
Position of modification - modification: t:32 - s2C

Comments:

The synthesis of s2C requires IscS as a sulfur donor and belongs to the “iron-cluster” pathway (as MiaB). Much sequence similarities exist between bacterial TtcA and yeast Tuc1 responsible for the thiolation of s2U34 (convergent evolution). They might have evolved from a common thiolase precursor.

Protein sequence:

MQENQQITKKEQYNLNKLQKRLRRNVGEAIADFNMIEEGDRIMVCLSGGKDSYTMLEILRNLQQSAPINF SLVAVNLDQKQPGFPEHVLPEYLEKLGVEYKIVEENTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATEL GATKIALGHHRDDILQTLFLNMFYGGKMKGMPPKLMSDDGKHIVIRPLAYCREKDIQRFADAKAFPIIPC NLCGSQPNLQRQVIADMLRDWDKRYPGRIETMFSAMQNVVPSHLCDTNLFDFKGITHGSEVVNGGDLAFD REEIPLQPACWQPEEDENQLDELRLNVVEVK

Enzymatic activities:

Reaction Substrate Type Position
C:s2C tRNA (t) Arg/ICG/prokaryotic cytosol 32
C:s2C tRNA (t) Arg/CCG/prokaryotic cytosol 32
C:s2C tRNA (t) Arg/{CU/prokaryotic cytosol 32
C:s2C tRNA (t) Ser/GCU/prokaryotic cytosol 32

Publications:

Title Authors Journal Details PubMed Id DOI
The conserved Cys-X1-X2-Cys motif present in the TtcA protein is required for the thiolation of cytidine in position 32 of tRNA from Salmonella enterica serovar Typhimurium. Jager G, Leipuviene R, Pollard MG, Qian Q, Bjork GR J Bacteriol [details] 14729701 -
Iron-sulfur cluster biosynthesis in bacteria: Mechanisms of cluster assembly and transfer. Fontecave M, Ollagnier-de-Choudens S Arch Biochem Biophys [details] 18191630 -
A conserved modified wobble nucleoside (mcm5s2U) in lysyl-tRNA is required for viability in yeast. Bjork GR, Huang B, Persson OP, Bystrom AS RNA [details] 17592039 -
TtcA a new tRNA-thioltransferase with an Fe-S cluster. Bouvier D, Labessan N, Clemancey M, Latour JM, Ravanat JL, Fontecave M, Atta M... Nucleic Acids Res [details] 24914049 -

Links:

_EcoCyc_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto