Full name: tRNA cytidine(34) acetyltransferase
Synonym: YpfI, JW2459
GI: 2495648
Orf: b2474
COG: COG1444
UniProt: P76562
Structures: | 2ZPA |
Complex:
Enzyme type: acetyltransferase
Position of modification - modification: t:34 - ac4C

Comments:

tRNAMet cytidine acetyltransferase. The substrate of this reaction is elongator tRNAMet. Apart from acetyltransferase it posses also a helicase domain.

Protein sequence:

MAELTALHTLTAQMKREGIRRLLVLSGEEGWCFEHTLKLRDALPGDWLWISPRPDAENHCSPSALQTLLG REFRHAVFDARHGFDAAAFAALSGTLKAGSWLVLLLPVWEEWENQPDADSLRWSDCPDPIATPHFVQHLK RVLTADNEAILWRQNQPFSLAHFTPRTDWYPATGAPQPEQQQLLKQLMTMPPGVAAVTAARGRGKSALAG QLISRIAGRAIVTAPAKASTDVLAQFAGEKFRFIAPDALLASDEQADWLVVDEAAAIPAPLLHQLVSRFP RTLLTTTVQGYEGTGRGFLLKFCARFPHLHRFELQQPIRWAQGCPLEKMVSEALVFDDENFTHTPQGNIV ISAFEQTLWQSDPETPLKVYQLLSGAHYRTSPLDLRRMMDAPGQHFLQAAGENEIAGALWLVDEGGLSQQ LSQAVWAGFRRPRGNLVAQSLAAHGNNPLAATLRGRRVSRIAVHPARQREGTGRQLIAGALQYTQDLDYL SVSFGYTGELWRFWQRCGFVLVRMGNHREASSGCYTAMALLPMSDAGKQLAEREHYRLRRDAQALAQWNG ETLPVDPLNDAVLSDDDWLELAGFAFAHRPLLTSLGCLLRLLQTSELALPALRGRLQKNASDAQLCTTLK LSGRKMLLVRQREEAAQALFALNDVRTERLRDRITQWQLFH

Enzymatic activities:

Reaction Substrate Type Position
C:ac4C tRNA (t)   34

Publications:

Title Authors Journal Details PubMed Id DOI
The RNA acetyltransferase driven by ATP hydrolysis synthesizes N4-acetylcytidine of tRNA anticodon. Ikeuchi Y, Kitahara K, Suzuki T EMBO J [details] 18668122 -
RNA helicase module in an acetyltransferase that modifies a specific tRNA anticodon. Chimnaronk S, Suzuki T, Manita T, Ikeuchi Y, Yao M, Suzuki T, Tanaka I EMBO J [details] 19322199 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto