Modomics - A Database of RNA Modifications

Full name:	Cysteine desulfurase IscS subfamily
Synonym:	NuvC
GI:	67466100
Orf:	b2530
COG:	COG1104
UniProt:	P0A6B7
Structures:	\| 1P3W \| 3LMV \|
Complex:
Enzyme type:	cysteine desulfurase
Position of modification - modification:

Comments:

The IscS protein is a pyridoxal phosphate-containing cysteine desulfurase involved in iron-sulfur cluster biogenesis. Cofactor of other enzymes involved in thio-modification of tRNA: MnmA (s2U34), MiaB (ms2 on i6A37), ThiI (s4U8), TtcA (s2C32), TtuA (s2U54). NifS is the homolog in yeast and plants.

Protein sequence:

MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITS
KTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLM
SFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGAPNI
LNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLNSIE
WAHH

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
IscS is a sulfurtransferase for the in vitro biosynthesis of 4-thiouridine in Escherichia coli tRNA.	Kambampati R, Lauhon CT	Biochemistry	[details]	10600118	-
Requirement for IscS in biosynthesis of all thionucleosides in Escherichia coli.	Lauhon CT	J Bacteriol	[details]	12446632	-
MnmA and IscS are required for in vitro 2-thiouridine biosynthesis in Escherichia coli.	Kambampati R, Lauhon CT	Biochemistry	[details]	12549933	-
Crystal structure of IscS, a cysteine desulfurase from Escherichia coli.	Cupp-Vickery JR, Urbina H, Vickery LE	J Mol Biol	[details]	12860127	-
The cysteine desulfurase IscS is required for synthesis of all five thiolated nucleosides present in tRNA from Salmonella enterica serovar typhimurium.	Nilsson K, Lundgren HK, Hagervall TG, Bjork GR	J Bacteriol	[details]	12446633	-
Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions.	Shi R, Proteau A, Villarroya M, Moukadiri I, Zhang L, Trempe JF, Matte A, Armengod ME, Cygler M	PLoS Biol	[details]	20404999	-
Structural alterations of the cysteine desulfurase IscS of Salmonella enterica serovar Typhimurium reveal substrate specificity of IscS in tRNA thiolation.	Lundgren HK, Bjork GR...	J Bacteriol	[details]	16585765	-

Links:

_PubMed_
_EcoCyc_

_PubMed_

_EcoCyc_