Full name: Selenide,water dikinase
Synonym: FdhB
GI: 134423
Orf: b1764
COG: COG0709
UniProt: P16456
Structures: | |
Complex:
Enzyme type: selenophosphate synthase
Position of modification - modification:

Comments:

Selenium donor protein. Catalyzes the magnesium-dependent synthesis of a labile selenium donor compound from selenide and ATP (formation of mono-selenophosphate). This compound is required both for the incorporation of selenium into the wobble uridine-34 of several mnm5s2U-containing tRNAs and for the biosynthesis of selenocysteine from an L-serine residue ester bonded to unique tRNA-Ser (anticodon UCA). Exchange of sulfur in mnm5s2U-tRNA into mnm5se2U-tRNA is catalyzed by SelU. In certain Eukarya SelD-like protein lacks the selenide-dependent monophosphate synthetase activity and catalyses only the biosynthesis of selenocysteine.

Protein sequence:

MSENSIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNGTSVISTTDFF MPIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAILGWPINKLSPEIAREVTEGGRYACRQAGIALAGGH SIDAPEPIFGLAVTGIVPTERVKKNSTAQAGCKLFLTKPLGIGVLTTAEKKSLLKPEHQGLATEVMCRMN IAGASFANIEGVKAMTDVTGFGLLGHLSEMCQGAGVQARVDYEAIPKLPGVEEYIKLGAVPGGTERNFAS YGHLMGEMPREVRDLLCDPQTSGGLLLAVMPEAENEVKATAAEFGIELTAIGELVPARGGRAMVEIR

Publications:

Title Authors Journal Details PubMed Id DOI
In vitro synthesis of selenocysteinyl-tRNA(UCA) from seryl-tRNA(UCA): involvement and characterization of the selD gene product. Leinfelder W, Forchhammer K, Veprek B, Zehelein E, Bock A Proc Natl Acad Sci U S A [details] 2405383 -
Escherichia coli mutant SELD enzymes. The cysteine 17 residue is essential for selenophosphate formation from ATP and selenide. Kim IY, Veres Z, Stadtman TC... J Biol Chem [details] 1527085 -
Selenophosphate synthetase. Enzyme properties and catalytic reaction. Veres Z, Kim IY, Scholz TD, Stadtman TC... J Biol Chem [details] 8144648 -
Biosynthesis of selenophosphate. Lacourciere GM... Biofactors [details] 10609888 -

Links:

_EcoCyc_
_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto