| Full name: | tRNA wyosine derivatives biosynthesis protein Taw1 | 
|---|---|
| Synonym: | MjTYW1 | 
| GI: | 2501613 | 
| Orf: | MJ0257 | 
| COG: | COG0731 | 
| UniProt: | Q57705 | 
| Structures: | | | | 
| Alpha Fold Predicted Structure: | AF-Q57705-F1 | 
| Enzyme type: | oxidoreductase | 
MIPEEIYKILRKQRYQIDGHTAVKLCGWVRKKMLEDKNCYKSKFYGIETHRCIQCTPSVIWCQQNCIFCWRVLPRDIGIDISQIKEPKWEEPEVVYEKILAMHKRIIMGYAGVLDRVGEKKFKEALEPKHVAISLSGEPTLYPYLDELIKIFHKNGFTTFVVSNGILTDVIEKIEPTQLYISLDAYDLDSYRRICGGKKEYWESILNTLDILKEKKRTCIRTTLIRGYNDDILKFVELYERADVHFIELKSYMHVGYSQKRLKKEDMLQHDEILKLAKMLDENSSYKLIDDSEDSRVALLQNENRKINPKL
Homologue of yeast Tyw1. Does not have the N-terminal FMN binding/flavodoxin domain found in Tyw1.
| Reaction | Substrate | SubstrateType | Position | (Anti)Codon | Modified (Anti)Codon | Amino Acid Change | Transcript Name | Transcript Region | Cellular Localization | References | 
|---|---|---|---|---|---|---|---|---|---|---|
| m1G:imG-14 | RNA | tRNA | 37 | GAA | GAA | tRNAPheGAA | anticodon-loop | Prokaryotic Cytosol | 22026549    | 
| Alpha Fold Pdb Files | AF-Q57705-F1.pdb   | 
| Alpha Fold Pdbx/mmCIF Files | AF-Q57705-F1.cif   | 
| DSSP Secondary Structures | Q57705.dssp   | 
| Title | Authors | Journal | Details | ||
|---|---|---|---|---|---|
| Crystal structure of the radical SAM enzyme catalyzing tricyclic modified base formation in tRNA. | Suzuki Y, Noma A, Suzuki T, Senda M, Senda T, Ishitani R, Nureki O | J Mol Biol | [details] | 17727881 | - | 
| Biosynthesis of wyosine derivatives in tRNA: an ancient and highly diverse pathway in Archaea. | de Crecy-Lagard V, Brochier-Armanet C, Urbonavicius J, Fernandez B, Phillips G, Lyons B, Noma A, Alvarez S, Droogmans L, Armengaud J, Grosjean H | Mol Biol Evol | [details] | 20382657 | - | 
| Pyruvate is the source of the two carbons that are required for formation of the imidazoline ring of 4-demethylwyosine. | Young AP, Bandarian V... | Biochemistry | [details] | 22026549 | - |