Full name: tRNA wyosine derivatives biosynthesis protein Taw1
Synonym: MjTYW1
GI: 2501613
Orf: MJ0257
COG: COG0731
UniProt: Q57705
Structures: | |
Complex:
Enzyme type: oxidoreductase
Position of modification - modification:

Comments:

Homologue of yeast Tyw1. Does not have the N-terminal FMN binding/flavodoxin domain found in Tyw1.

Protein sequence:

MIPEEIYKILRKQRYQIDGHTAVKLCGWVRKKMLEDKNCYKSKFYGIETHRCIQCTPSVIWCQQNCIFCW RVLPRDIGIDISQIKEPKWEEPEVVYEKILAMHKRIIMGYAGVLDRVGEKKFKEALEPKHVAISLSGEPT LYPYLDELIKIFHKNGFTTFVVSNGILTDVIEKIEPTQLYISLDAYDLDSYRRICGGKKEYWESILNTLD ILKEKKRTCIRTTLIRGYNDDILKFVELYERADVHFIELKSYMHVGYSQKRLKKEDMLQHDEILKLAKML DENSSYKLIDDSEDSRVALLQNENRKINPKL

Enzymatic activities:

Reaction Substrate Type Position
m1G:imG-14 tRNA (t) 37

Publications:

Title Authors Journal Details PubMed Id DOI
Crystal structure of the radical SAM enzyme catalyzing tricyclic modified base formation in tRNA. Suzuki Y, Noma A, Suzuki T, Senda M, Senda T, Ishitani R, Nureki O J Mol Biol [details] 17727881 -
Biosynthesis of wyosine derivatives in tRNA: an ancient and highly diverse pathway in Archaea. de Crecy-Lagard V, Brochier-Armanet C, Urbonavicius J, Fernandez B, Phillips G, Lyons B, Noma A, Alvarez S, Droogmans L, Armengaud J, Grosjean H Mol Biol Evol [details] 20382657 -
Pyruvate is the source of the two carbons that are required for formation of the imidazoline ring of 4-demethylwyosine. Young AP, Bandarian V... Biochemistry [details] 22026549 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto