Full name: tRNA wyosine derivatives biosynthesis protein Taw1
Synonym: Tyw1
GI: 74571635
Orf: PH1705
COG: COG0731
UniProt: O59412
Structures: | 2YX0 |
Complex:
Enzyme type: oxidoreductase
Position of modification - modification:

Comments:

Homologue of yeast Tyw1. Does not have the N-terminal FMN binding/flavodoxin domain found in Tyw1. Predicted to participate in the m1G:imG-14 reaction.

Protein sequence:

MMEMITIKPGKITVQANPNMPKEVAELFRKQHYEIVGRHSGVKLCHWLKKSLTEGRFCYKQKFYGIHSHR CLQMTPVLAWCTHNCIFCWRPMENFLGTELPQPWDDPAFIVEESIKAQRKLLIGYKGNPKVDKKKFEEAW NPTHAAISLSGEPMLYPYMGDLVEEFHKRGFTTFIVTNGTIPERLEEMIKEDKLPTQLYVSITAPDIETY NSVNIPMIPDGWERILRFLELMRDLPTRTVVRLTLVKGENMHSPEKYAKLILKARPMFVEAKAYMFVGYS RNRLTINNMPSHQDIREFAEALVKHLPGYHIEDEYEPSRVVLIMRDDVDPQGTGVEGRFIKH

Publications:

Title Authors Journal Details PubMed Id DOI
Biosynthesis of wyosine derivatives in tRNA: an ancient and highly diverse pathway in Archaea. de Crecy-Lagard V, Brochier-Armanet C, Urbonavicius J, Fernandez B, Phillips G, Lyons B, Noma A, Alvarez S, Droogmans L, Armengaud J, Grosjean H Mol Biol Evol [details] 20382657 -
Structure of an archaeal TYW1, the enzyme catalyzing the second step of wye-base biosynthesis. Goto-Ito S, Ishii R, Ito T, Shibata R, Fusatomi E, Sekine SI, Bessho Y, Yokoyama S Acta Crystallogr D Biol Crystallogr [details] 17881823 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto