Modomics - A Database of RNA Modifications

Full name: tRNA wyosine derivatives biosynthesis protein Taw2
Synonym:
GI: 3025176
Orf: MJ1557
COG: COG2520
UniProt: Q58952
Structures: | 3A27 |
Complex:
Enzyme type: Alpha-amino-alpha-carboxypropyltransferase
Position of modification - modification:

Comments:

Homologue of yeast Tyw2. It catalyzes the transfer of the “acp” group from AdoMet to the C7 position of the imG-14 base, forming yW-86. It was shown to act on tRNAPhe from yeast mutant strain which possess imG-14 in position 37.

Protein sequence:

MGIKYQKIGDVVIVKKELSEDEIREIVKRTKCKAILLYTTQITGEFRTPHVKILYGKETETIHKEYGCLFKLDVAKIMWSQGNIEERKRMAFISNENEVV
VDMFAGIGYFTIPLAKYSKPKLVYAIEKNPTAYHYLCENIKLNKLNNVIPILADNRDVELKDVADRVIMGYVHKTHKFLDKTFEFLKDRGVIHYHETVAE
KIMYERPIERLKFYAEKNGYKLIDYEVRKIKKYAPGVWHVVVDAKFERI

Enzymatic activities:

Reaction Substrate Type Position
imG-14:yW-86 tRNA (t) Phe-imG14/#AA/prokaryotic cytosol 37

Publications:

Title Authors Journal Details PubMed Id DOI
Biosynthesis of wyosine derivatives in tRNA: an ancient and highly diverse pathway in Archaea. de Crecy-Lagard V, Brochier-Armanet C, Urbonavicius J, Fernandez B, Phillips G, Lyons B, Noma A, Alvarez S, Droogmans L, Armengaud J, Grosjean H Mol Biol Evol [details] 20382657 -
Structural basis of AdoMet-dependent aminocarboxypropyl transfer reaction catalyzed by tRNA-wybutosine synthesizing enzyme, TYW2. Umitsu M, Nishimasu H, Noma A, Suzuki T, Ishitani R, Nureki O Proc Natl Acad Sci U S A [details] 19717466 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca