Modomics - A Database of RNA Modifications

Full name:	tRNA wyosine derivatives biosynthesis protein Taw2
Synonym:
GI:	74570968
Orf:	PH0793
COG:	COG2520
UniProt:	O58523
Structures:	\| 3A25 \| 3A26 \|
Complex:
Enzyme type:	Alpha-amino-alpha-carboxypropyltransferase
Position of modification - modification:

Comments:

Homologue of yeast Tyw2. It catalyzes the transfer of the “acp” group from AdoMet to the C7 position of the imG-14 base, forming yW-86. It was shown to act on tRNAPhe from yeast mutant strain which possess imG-14 in position 37.

Protein sequence:

MRTQGIKPRIREILSKELPEELVKLLPKRWVRIGDVLLLPLRPELEPYKHRIAEVYAEVLGVKTVLRKGHIHGETRKPDYELLYGSDTVTVHVENGIKYK
LDVAKIMFSPANVKERVRMAKVAKPDELVVDMFAGIGHLSLPIAVYGKAKVIAIEKDPYTFKFLVENIHLNKVEDRMSAYNMDNRDFPGENIADRILMGY
VVRTHEFIPKALSIAKDGAIIHYHNTVPEKLMPREPFETFKRITKEYGYDVEKLNELKIKRYAPGVWHVVLDLRVFKS

Enzymatic activities:

Reaction	Substrate	Type	Position
imG-14:yW-86	tRNA (t)	Phe-imG14/#AA/prokaryotic cytosol	37

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Biosynthesis of wyosine derivatives in tRNA: an ancient and highly diverse pathway in Archaea.	de Crecy-Lagard V, Brochier-Armanet C, Urbonavicius J, Fernandez B, Phillips G, Lyons B, Noma A, Alvarez S, Droogmans L, Armengaud J, Grosjean H	Mol Biol Evol	[details]	20382657	-
Structural basis of AdoMet-dependent aminocarboxypropyl transfer reaction catalyzed by tRNA-wybutosine synthesizing enzyme, TYW2.	Umitsu M, Nishimasu H, Noma A, Suzuki T, Ishitani R, Nureki O	Proc Natl Acad Sci U S A	[details]	19717466	-