Full name: Fibrillarin-like rRNA/tRNA 2′-O-methyltransferase
Synonym: aFib, Fibrillarin-like
GI: 15897821
Orf: C33_014
COG: COG1889
UniProt: P58032
Structures: | 3PLA | 3ID5 | 3ID6 |
Complex: C/D RNP
Enzyme type: methyltransferase
Position of modification - modification: l:many - Xm
s:many - Xm

Comments:

Homologue of yeast Nop1 protein and human fibrillarin. A catalytic subunit of C/D RNP complex, which in Archaea is composed of FlpA (fibrillarin), L7Ae and Nop56/58 proteins.

Protein sequence:

MSEVITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLK TNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSY KSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFET IQIINLDPYDKDHAIVLSKYKG

Publications:

Title Authors Journal Details PubMed Id DOI
Structural organization of box C/D RNA-guided RNA methyltransferase. Ye K, Jia R, Lin J, Ju M, Peng J, Xu A, Zhang L Proc Natl Acad Sci U S A [details] 19666563 -
Structural basis for site-specific ribose methylation by box C/D RNA protein complexes. Lin J, Lai S, Jia R, Xu A, Zhang L, Lu J, Ye K Nature [details] 21270896 -

Links:

_Wikipedia_
_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto