Full name: Fibrillarin-like rRNA/tRNA 2′-O-methyltransferase
Synonym: aFib, MJ0697, Fibrillarin-like
GI: 15668878
Orf:
COG: COG1889
UniProt: Q58108
Structures: | 1G8S | 1FBN |
Complex: C/D RNP
Enzyme type: methyltransferase
Position of modification - modification: l:many - Xm
s:many - Xm

Comments:

Homologue of yeast Nop1 protein and human fibrillarin. A catalytic subunit of C/D RNP complex, which in Archaea is composed of FlpA (fibrillarin), L7Ae and Nop56/58 proteins.

Protein sequence:

MEDIKIKEIFENIYEVDLGDGLKRIATKSIVKGKKVYDEKIIKIGDEEYRIWNPNKSKLAAAIIKGLKVM PIKRDSKILYLGASAGTTPSHVADIADKGIVYAIEYAPRIMRELLDACAERENIIPILGDANKPQEYANI VEKVDVIYEDVAQPNQAEILIKNAKWFLKKGGYGMIAIKARSIDVTKDPKEIFKEQKEILEAGGFKIVDE VDIEPFEKDHVMFVGIWEGK

Publications:

Title Authors Journal Details PubMed Id DOI
Crystal structure of a fibrillarin homologue from Methanococcus jannaschii, a hyperthermophile, at 1.6 A resolution. Wang H, Boisvert D, Kim KK, Kim R, Kim SH EMBO J [details] 10654930 -
Expression, purification and preliminary X-ray analysis of a fibrillarin homolog from Methanococcus jannaschii, a hyperthermophile. Wang H, Yokota H, Kim R, Kim SH Acta Crystallogr D Biol Crystallogr [details] 10089444 -

Links:

_Wikipedia_
_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto